KEGG   Naumovozyma castellii: NCAS_0F01390Help
Entry
NCAS_0F01390      CDS       T02233                                 

Gene name
NCAS0F01390
Definition
(RefSeq) hypothetical protein
  KO
K18932  palmitoyltransferase [EC:2.3.1.225]
Organism
ncs  Naumovozyma castellii
Brite
KEGG Orthology (KO) [BR:ncs00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    NCAS_0F01390 (NCAS0F01390)
Enzymes [BR:ncs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     NCAS_0F01390 (NCAS0F01390)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHHC InPase
Motif
Other DBs
NCBI-GeneID: 11527375
NCBI-ProteinID: XP_003676978
UniProt: G0VGK2
Position
6:complement(275879..277003)
Genome map
AA seq 374 aa AA seqDB search
MGFRFNLEGPLLRYVLPQITFALQIYGTWAYSHKFCYAQLFHRFHYKATSIVFIIIECVL
TIIIWIIWVRLIYFNKPMEQPIIPPYMLVPVGSSSNQVISTKPPKYYQCDKNGYPPWCTH
CQSLKLSRSHHSKQVGRCILRFDHYCAWIGCVIARNNYRLFLQYVGWFNLLLLWYWLTIA
VFIRTIGMLNGNVIVGFILSCLGWMMTLGLFISHIYYMSNNKTSIETLDAERGKRKKHKM
MVTNDEIEHARIEYNRKYFCYYNQQDKFRYVVELTADEFAKCWKKRSFWINAREFLGSDI
IFWLFPWGSYFPDLRKREASSFQSYGQSYDLENIIGPYKEVLSSSAIDLIENRITQGNYV
TKFLAYGDNLDINM
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgggcttccgttttaacctcgaaggccctctgttgcgatatgttcttccccaaatcact
tttgctctacaaatatacggaacatgggcctatagccataaattttgctatgctcaacta
ttccacagattccattacaaggcaacttcaatagtcttcattatcattgaatgtgttctt
acgatcataatatggatcatttgggttcgtttaatttattttaataagccaatggaacaa
cctataattccgccatatatgcttgtccccgtcggctcgtcatcaaaccaggtaatctct
acaaagccccccaaatattaccaatgtgataagaacggttatccaccatggtgtactcat
tgccaaagtttgaaattgagtaggtcacatcattccaaacaagttggaagatgcatactt
agattcgatcattattgtgcatggattggatgcgtcattgcaagaaataattataggctg
tttttgcaatacgtaggctggtttaacttattactactttggtattggctaactattgcg
gtgtttattagaactattgggatgctaaatgggaatgtcattgtcggattcatactgagt
tgccttggttggatgatgactctaggtttatttatcagccacatctattatatgagtaac
aataaaacatcaatcgagacactagatgccgaacggggcaaacggaaaaagcacaagatg
atggtaactaacgatgaaattgaacacgccaggattgaatataacagaaaatacttctgt
tattataaccaacaagataaatttagatatgttgttgaattgacagcggatgaatttgca
aaatgctggaagaaacgttctttttggataaatgcaagagaatttcttggttccgatatc
attttctggttgtttccatggggatcttacttcccagacttgagaaaaagagaagcatcc
tcattccaatcatatggtcaatcatatgatttggagaatattattggaccttataaagaa
gtcttaagttcttcagcaattgaccttatcgaaaacaggataacgcaaggcaattatgtt
actaaattcctagcatatggagacaaccttgatataaatatgtag

DBGET integrated database retrieval system