KEGG   Naumovozyma castellii: NCAS_0G01350Help
Entry
NCAS_0G01350      CDS       T02233                                 

Gene name
NCAS0G01350
Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ncs  Naumovozyma castellii
Pathway
ncs00480  Glutathione metabolism
ncs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncs00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    NCAS_0G01350 (NCAS0G01350)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ncs02000]
    NCAS_0G01350 (NCAS0G01350)
Enzymes [BR:ncs01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     NCAS_0G01350 (NCAS0G01350)
Transporters [BR:ncs02000]
 Other transporters
  Pores ion channels [TC:1]
   NCAS_0G01350 (NCAS0G01350)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_N_3 GST_N_2 GST_C_3 GST_C_2 Pex14_N Zip
Motif
Other DBs
NCBI-GeneID: 11528613
NCBI-ProteinID: XP_003677375
UniProt: G0VHY8
Position
7:complement(241218..242291)
Genome map
AA seq 357 aa AA seqDB search
MNNLNGHTNQISNLSNALQQVNIDNSNTTTDQSNINFDVSSNENSNHNSQHNSDSNILEQ
NYSNTESNRQEQLQQQQQQQQQQQQQQQQQQQQHAPFGDIEYSRITKFFQNQPMEGYTLF
SHRSAPNGFKVAIILSELGLQYNTIFLDFNLGEHRAPEFVSVNPNARVPALIDHSMDNLS
IWESGAILLHLVNKYYKETGDPLLWSDDLADQAQINAWLFFQTSGHAPMIGQALHFSYFH
SQKIPSAIERYTDEVRRVYGVVEMALAERREAMVMELDTDNAAAYSSGTTPMSQSRFFDY
PVWLVGDKLTIADLAFVPWNNVVDRIGINIKTEFPEVYKWTKHMMRRPAVVKALRGE
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaataacttaaatggacatacgaatcaaatctctaatctttcaaatgcactacaacaa
gtgaatatagataatagtaatactactactgatcaaagcaatataaattttgacgtctcc
tccaatgaaaatagtaatcataacagtcaacataatagcgatagcaatattctagaacag
aactactctaatacagaaagtaatcgacaagaacaattgcaacagcaacagcagcagcaa
caacaacagcagcaacaacagcaacagcaacaacagcagcatgcgccattcggggatata
gaatactccagaattaccaaattcttccaaaatcaacccatggaaggctacactctattt
tctcacagatcagctccaaacgggtttaaagtagccattattctaagtgaattaggattg
caatacaatacaatttttctcgattttaatcttggtgaacatagagcaccagaatttgta
tctgtgaatcctaatgccagagtgcccgctttaatcgatcatagtatggataatctctcc
atatgggaatccggtgcgatcttattacatttagtaaataaatattataaggaaactggt
gatccattgctttggtctgacgatttggctgatcaagctcaaattaatgcgtggttattc
ttccaaacttctggtcatgcacccatgattggacaagctttacatttcagttatttccat
tcgcagaagattccaagtgccattgaaagatatacggatgaagtgagaagagtttatgga
gtagtggagatggctttggctgagagaagagaggccatggttatggaattggataccgat
aatgcagcagcttattcttcaggtaccacaccaatgtcacagagtaggttctttgattat
cccgtatggttagtgggtgataaattgactattgcagatttggcatttgtaccctggaat
aatgtcgtagatagaattggaataaatattaagacagaattccctgaagtttacaaatgg
accaaacatatgatgagaaggcctgcagtggtaaaggctctacgtggagaatag

DBGET integrated database retrieval system