KEGG   Naumovozyma castellii: NCAS_0G02510Help
Entry
NCAS_0G02510      CDS       T02233                                 

Gene name
NCAS0G02510
Definition
(RefSeq) hypothetical protein
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
ncs  Naumovozyma castellii
Pathway
ncs00620  Pyruvate metabolism
ncs00630  Glyoxylate and dicarboxylate metabolism
ncs01100  Metabolic pathways
ncs01110  Biosynthesis of secondary metabolites
ncs01200  Carbon metabolism
Module
ncs_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NCAS_0G02510 (NCAS0G02510)
   00630 Glyoxylate and dicarboxylate metabolism
    NCAS_0G02510 (NCAS0G02510)
Enzymes [BR:ncs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     NCAS_0G02510 (NCAS0G02510)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-GeneID: 11528571
NCBI-ProteinID: XP_003677490
UniProt: G0VIA3
Position
7:449563..451227
Genome map
AA seq 554 aa AA seqDB search
MVKVSLDNVQLLVDIDKQPAFPPSQTTVATILSKEALEFIVLLHRTFNERRKALLANRQQ
VQARLDSGNYQLDFLPETANIRSDPVWQGPTLAPGLINRGCEITGPPLRNMLINALNSDV
NTYMTDFEDSMSPTWNNVIYGQVNLFDAVRDQINFKTPRKEYKLNDKFENLPTVIVRPRG
WHLLEKHLIVDNEPISASIFDFGLFFYNNANKLVSLGKGPYFYLPKMEHHLEAKLWNDIF
NVAQDYIGMTRGTIRATVLIETLPAAFQMEEIIYQLRQHSSGLNCGRWDYIFSTIKRLRN
LPQHVLPNRDQVTMTSPFMNAYVKRLINTCHRRGVHAMGGMAAQIPIKDDPKANETAMNK
VRTDKIRELTNGHDGSWIAHPALAAICNEVFINMGTANQIHYVPDCNITAGNLVETNIVG
GQVTIEGIKQNLDIGLQYMEAWLRGSGCVPINNLMEDAATAEVSRCQLYQWVHHGVVLSD
TGEKVTPQLTEQLLNEQVAKLSKASPLGNKNKYATAAKYFLPEIKGEKCSEFLTTLLYDE
IVTKKSRPTDLSKL
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaagtatccctggacaacgtgcaactgctagtcgacatcgacaaacaacctgct
ttcccaccttcgcaaacaaccgtcgctaccatcctctccaaagaggcactcgaattcatc
gttctcttgcatcgcactttcaatgaaagacgcaaggccttgctagccaacagacaacaa
gtacaggcaagattggattccggcaactaccaactggatttccttcctgaaacggcaaac
attagaagcgatcccgtgtggcagggccccactttggctcccggcttgatcaatagaggt
tgtgagattacaggcccacctttaagaaacatgttgatcaacgcactaaactcagatgtc
aatacttatatgaccgattttgaagactccatgtcccccacttggaataacgtcatttac
ggtcaggttaacttgttcgatgccgtgagagatcaaattaatttcaagacgccaagaaag
gaatataaattgaatgataaattcgaaaatttaccaactgtcattgtgagacctcgtgga
tggcatctactggaaaagcatttgattgtggataatgaacccatctctgcatccatcttc
gatttcggtctgttcttttacaataacgctaacaaattagtttctctgggaaaaggtcct
tacttttacttgcccaagatggaacatcatttggaagccaaattatggaatgatatcttt
aacgtcgcacaggattacatcggaatgacacgtggtaccattagagccacagtccttatt
gaaactttacccgctgctttccaaatggaggaaatcatttatcaattgagacagcattca
agtgggttgaattgtggtcgttgggattacatattctctacaattaaaagattaagaaat
ttaccacaacatgtattaccaaatagagatcaagtgacaatgacctcccccttcatgaac
gcatacgtgaaacgtttaattaacacgtgtcatcgtcgtggtgtccatgcaatgggtggt
atggccgctcaaatccccatcaaggatgacccaaaggctaatgaaacagcaatgaataaa
gtgagaactgacaagattagagaattgactaatggtcatgatggctcttggatcgcacac
cctgcattggctgccatttgtaatgaagttttcatcaatatggggacagcaaatcaaatt
cattacgtaccagattgtaacatcactgctggaaatttggtagagacaaatatcgtcggg
ggacaagtcaccatcgagggtatcaaacaaaatttggacattgggttgcaatacatggaa
gcctggttgagaggttcaggttgtgtccccattaataacttgatggaagatgctgctact
gctgaagtgtctcgttgtcaattgtatcaatgggttcatcatggtgtggttctcagtgac
acgggtgaaaaagtaactccacaattaactgaacagttgttgaatgaacaagtggcaaaa
ttatccaaggcaagtccattggggaacaagaacaaatacgctactgctgctaaatacttc
ttgcccgaaatcaaaggtgaaaagtgtagtgaattcttaaccactttattgtacgatgaa
atcgtaaccaaaaaatcccgtccaacagacttgagcaagttgtga

DBGET integrated database retrieval system