KEGG   Naumovozyma castellii: NCAS_0H00510Help
Entry
NCAS_0H00510      CDS       T02233                                 

Gene name
NCAS0H00510
Definition
(RefSeq) hypothetical protein
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ncs  Naumovozyma castellii
Pathway
ncs04146  Peroxisome
ncs04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:ncs00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    NCAS_0H00510 (NCAS0H00510)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    NCAS_0H00510 (NCAS0H00510)
Enzymes [BR:ncs01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     NCAS_0H00510 (NCAS0H00510)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C
Motif
Other DBs
NCBI-GeneID: 11529021
NCBI-ProteinID: XP_003677711
UniProt: G0VIN5
Position
8:complement(88195..89007)
Genome map
AA seq 270 aa AA seqDB search
MRGGIKICRYARGVRSLHTVPKLTNVSRLSKEGIPRILSGKGFDIAWNQYQLSMVNRLNL
AVAGTALESMFPFHILLKTARDRHQAHIFNLASGLHNNHLFMENIIPGATTEGPSSLFLE
KVRESFDGKSWDVVKEEMLEQSLTGCLGQGWLFLVEREDKRLESMICHNNGTPYYFGRNQ
MLDLNSSVTLAEFTHWEDMKSVIRDSSKGKLKEKNVVKDWTIPLICINLGDVAYLNDYGI
LKRREYVKNCLDNLNWSVINNRLYSSTSSL
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgagaggaggaatcaagatatgtcgatatgctagaggggttagatccttgcatacagtt
cctaaattaacgaatgtgagtcgtctgtccaaagaaggtataccgaggatacttagtggg
aaggggtttgatattgcctggaatcaatatcaattgtcgatggttaataggttgaacttg
gctgtggctgggacggcattggaatcgatgtttcccttccatatcctgttgaagacggct
agagatagacatcaggcacacatatttaatttggcatcaggtttgcataataaccatctg
ttcatggagaatattatcccgggggccacaacggagggtccctcatcgttattcttggag
aaagtgagggagtcatttgatgggaagagttgggatgttgttaaggaagagatgttggaa
caaagtttgactggttgtttgggtcaaggatggttatttcttgtagaaagagaggataaa
cgattggagagcatgatttgtcataataatgggacaccgtattattttggtcgtaatcaa
atgcttgatttgaattctagtgttactctggctgaatttactcattgggaagatatgaaa
agtgtaattcgtgattccagcaagggtaaattgaaagaaaagaatgtcgttaaggattgg
accatcccgttgatttgtattaatttgggtgacgttgcatatttgaatgattatgggata
ttgaagaggagagagtatgtgaagaattgtttggataatttgaattggtctgtgatcaat
aatcggttatattcgtcgacgagttcgttatga

DBGET integrated database retrieval system