KEGG   Naumovozyma castellii: NCAS_0I02580
Entry
NCAS_0I02580      CDS       T02233                                 

Gene name
NCAS0I02580
Definition
(RefSeq) hypothetical protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
ncs  Naumovozyma castellii
Pathway
ncs00100  Steroid biosynthesis
ncs01100  Metabolic pathways
ncs01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ncs00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    NCAS_0I02580 (NCAS0I02580)
Enzymes [BR:ncs01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     NCAS_0I02580 (NCAS0I02580)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 11525630
NCBI-ProteinID: XP_003678268
UniProt: G0VK92
Position
9:481843..483171
AA seq 442 aa
MTKKSSLNPKTTKFEFGGVLGTMVMTVALPILSVILNQMIRPDYHIEGCFRNFDWNRVTQ
GLQPVSGLISNTRTWTYYILWFLSLLFFDTVLPGKWMQGITLRDGSSLWYKINGISVVAM
LSLILAVRWKLTDGLMPELQYLYSHQVELCVVSIIFAFILACYCYVVSFIPLLFNKTNKE
GTKEKILAVGGNSGNIIYDWFIGRELNPRIGPIDIKMFCELRPGMMLWLLINLSCLHNYY
LEYDGKINDALLLINLLQGFYILDGVLNEEGVLSMMDITTDGFGFMLAFGDLTFVPFTYS
LQARYLSVSPIHLGYVKFFSILSLMCLGYWIFHSSNSQKSKFRQGKLSHLKSIQTKRGTK
LLCDGWWAKSQHMNYFGDWLISLSWCLTTWFQTPLTYYYSLYFATLLLHRQQRDEEKCHE
KYGKDWEEYQRKVPYKIIPYVY
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgacgaagaagtcttctttgaaccctaaaacaacaaagttcgaatttggtggggtccta
ggtacaatggtcatgaccgtggcactccccattctctccgtcatactaaaccaaatgatc
agaccagattatcatattgaaggctgtttccggaattttgactggaatcgagtaactcaa
ggattacagccagtctcaggattgatctctaatacccgtacttggacatattacatactc
tggtttctatcattgctattctttgacacggtgctacctggaaaatggatgcaagggatt
acgctaagagatggaagttcgttatggtataagattaatggtattagcgtagtagccatg
ctatctttgatattggcagttagatggaaattgacggatggtctaatgccagagttgcaa
tatttatactctcatcaagttgaactatgtgttgtcagtatcatttttgcatttatacta
gcctgctattgttacgtggttagtttcatcccacttttattcaataaaacaaataaagag
ggaacaaaggagaaaatactagctgttggtggtaactctggaaatattatttatgattgg
ttcattggaagggaattgaacccaagaattgggcccattgatattaagatgttttgtgaa
ctaagaccaggtatgatgttatggttgctgatcaatttatcatgtttacataattattat
ttggagtatgacggcaaaattaatgatgccctattgcttataaatttgcttcaagggttt
tatatccttgatggggtgttgaatgaggaaggtgtgctatcaatgatggacattaccact
gatggatttggatttatgctagcatttggagatctaacgtttgtcccatttacttattct
ttacaggcaagataccttagcgtttcaccaatccatctaggctatgtcaaatttttctcg
atcttaagtttaatgtgccttgggtattggatttttcattcatctaactcgcaaaaatcg
aaatttagacaggggaaattatcacatttgaaaagtattcaaactaaacgtggaaccaaa
ttattatgtgatggttggtgggcgaaatctcaacatatgaactattttggcgattggtta
atctcattaagttggtgtttaactacctggtttcaaacccctttaacatattattattcc
ttatattttgcaacactattgctacacaggcagcaacgagatgaagaaaaatgtcacgaa
aaatacggtaaggattgggaagaatatcaacggaaagttccatataaaattattccgtat
gtatattaa

DBGET integrated database retrieval system