KEGG   Candidatus Nitrosomarinus catalina: NMSP_1163Help
Entry
NMSP_1163         CDS       T04846                                 

Definition
(GenBank) precorrin-2 dehydrogenase
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
nct  Candidatus Nitrosomarinus catalina
Pathway
nct00860  Porphyrin and chlorophyll metabolism
nct01100  Metabolic pathways
nct01110  Biosynthesis of secondary metabolites
nct01120  Microbial metabolism in diverse environments
Module
nct_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:nct00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NMSP_1163
Enzymes [BR:nct01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     NMSP_1163
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     NMSP_1163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 Shikimate_DH Sirohm_synth_M TrkA_N Oxidored_nitro DUF4951
Motif
Other DBs
NCBI-ProteinID: ARS64779
UniProt: A0A2Z2HQ14
Position
919619..920272
Genome map
AA seq 217 aa AA seqDB search
MIINLNLEGKKIIVVGGGNEAEKRIKSILNEKCEILVISDSINKQIKNWVKIKKIKLKKQ
KIENLKCITELKPDLIITTTNDRKINQKIITYAKKRKTIVYSSDNPDDSDFSNASIIDFE
KTIQIAIFTGGKSPAMSKKIKSKSEKALKKVILKEDIDQIKIQKISRKLAKEIIPTQFER
KQCLNNIMNDKHIDQLIKDGQVKKAEKRAIEIIKKWK
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgataattaatctaaatctagaaggtaaaaaaatcattgtcgtaggtggaggaaacgaa
gcagaaaaaagaattaaatcaatattaaatgaaaaatgtgaaattttagtaattagtgat
tccataaacaaacaaattaaaaattgggttaaaataaaaaaaattaaattaaaaaaacag
aaaattgaaaatttaaaatgtattacagaattgaaaccagatttaataattacaaccaca
aatgatagaaaaattaatcaaaagataatcacgtatgcaaaaaagagaaaaaccatcgta
tatagttcagataatccagatgacagtgatttttcaaatgcatcaataatagattttgaa
aaaacaatacaaattgcaatttttactggcggtaaaagtccagcaatgtccaaaaagatt
aaatcaaaatctgaaaaagcactaaaaaaagtaattttgaaagaagatattgatcaaatt
aagattcagaaaatatcacgaaaacttgctaaagagatcattcccactcaattcgaacga
aaacagtgcttgaacaacatcatgaatgacaagcatattgatcagttaataaaagacggt
caggtaaaaaaggcagaaaagcgagcaatagagataattaaaaaatggaaatga

DBGET integrated database retrieval system