KEGG   Candidatus Nitrosocaldus cavascurensis: NCAV_1150Help
Entry
NCAV_1150         CDS       T05329                                 

Gene name
hemL
Definition
(GenBank) Glutamate-1-semialdehyde 2,1-aminomutase 2
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
ncv  Candidatus Nitrosocaldus cavascurensis
Pathway
ncv00860  Porphyrin and chlorophyll metabolism
ncv01100  Metabolic pathways
ncv01110  Biosynthesis of secondary metabolites
ncv01120  Microbial metabolism in diverse environments
Module
ncv_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:ncv00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NCAV_1150 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ncv01007]
    NCAV_1150 (hemL)
Enzymes [BR:ncv01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     NCAV_1150 (hemL)
Amino acid related enzymes [BR:ncv01007]
 Aminotransferase (transaminase)
  Class III
   NCAV_1150 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: SPC34325
UniProt: A0A2K5ARS4
Position
NCAV:complement(1000423..1001799)
Genome map
AA seq 458 aa AA seqDB search
MYNHSRGVQEQQADELMSKYIKHYEAKTGRSRQLFMHASSLLPSGTSHNIRYFEPYPFFA
RMASGKYIYDVDGNAYTDYWMGHWSLILGHAPKVVVDVLRERVVEGTIFGTVNEHALRLA
EIINRLMPRAEMLRFVSTGSEATMYAVRLARAYTGKRIVAKIEGGWHGFNTDLMHSVNYP
FDEPEGKGMLEEEMRYLVALPFNDVESSISILNKVKDDLACIIVEPLLGGAGCIPADKEY
LHVLQEYARKSSALFILDEIVTGFRLSLHGAQQIYSLEPDLFTLGKIAGGGLPIGVVCGL
KEVMNLADVRGKGKWDRVSIGGGTYSENPLSMSAGAAVLEYLASNRDIYERLEMLGDEVR
RGIDRVMVDHGIRVKSTGMGSLFLTHFLKDGVEDVRSARDAVQCDLRMQRLYHFALLSMY
DIFFLPNKLGAISIEHDSIDIRRLVDASERIASDMASM
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
ttgtacaatcatagtagaggtgtgcaggagcagcaagcagatgagttgatgagcaagtac
ataaagcattatgaggctaagactggtagatcaaggcaactcttcatgcatgcatcatcc
ctgctcccatctggcactagccacaatataaggtactttgagccctatcctttctttgct
aggatggcatctggcaagtacatatatgatgttgatggcaatgcttacacagactactgg
atggggcactggagcctcatacttgggcatgcaccaaaggttgttgttgatgtattgagg
gagagggttgtagagggtaccatatttggtactgttaatgagcatgcactaaggcttgca
gagatcataaacaggctcatgccaagggcagagatgctaagattcgtaagtacaggatct
gaggcaacaatgtatgctgttaggctagcaagggcatatacaggaaagaggatagtagca
aagatagagggaggatggcatggctttaatacagatctgatgcactctgttaactaccca
ttcgatgagcctgagggtaaaggaatgcttgaggaggagatgaggtatttagttgcactc
ccattcaacgatgtagagtcatcaataagcatactaaacaaggttaaggatgatctagcc
tgtataatagttgaaccattgcttggaggggcaggatgcatccctgctgataaggagtat
cttcatgtacttcaagagtatgcaaggaagagtagtgcactattcatcttggatgagata
gtaacagggttcaggctatcactgcatggggcacaacagatctactccctagagccagat
ctattcacccttggcaagatagcagggggagggcttcctataggagttgtatgtggactc
aaggaggttatgaaccttgcagatgttagaggtaaggggaagtgggatagggtaagtatt
ggaggaggcacgtattcagagaacccattgagcatgtctgcaggtgctgctgtacttgag
tatctagcaagtaatagagatatctatgagaggctggagatgcttggggatgaggttaga
aggggtatagatagggtaatggtagatcatggtataagggttaagagcactggtatgggc
tcactcttcctaacacacttccttaaggatggggttgaggatgttaggagtgcaagggat
gctgttcaatgtgatcttagaatgcagaggctctaccactttgcactcttgagcatgtat
gatatcttcttcctaccaaacaaacttggggcaataagtattgagcatgatagcatagat
ataaggaggcttgtggatgcaagtgagaggatagcaagtgatatggcaagtatgtag

DBGET integrated database retrieval system