KEGG   Candidatus Nitrosocaldus cavascurensis: NCAV_1761Help
Entry
NCAV_1761         CDS       T05329                                 

Definition
(GenBank) Nicotinamide-nucleotide adenylyltransferase
  KO
K00952  nicotinamide-nucleotide adenylyltransferase [EC:2.7.7.1]
Organism
ncv  Candidatus Nitrosocaldus cavascurensis
Pathway
ncv00760  Nicotinate and nicotinamide metabolism
ncv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncv00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    NCAV_1761
Enzymes [BR:ncv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     NCAV_1761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_like Citrate_ly_lig
Motif
Other DBs
NCBI-ProteinID: SPC34924
UniProt: A0A2K5ATI8
Position
NCAV:complement(1543777..1544325)
Genome map
AA seq 182 aa AA seqDB search
MHGLLVGRFQPFHLGHLSAVEYALKSMDMLWLVIGSADKSHEPRNPFTAGERLEMIKYAL
DAHGIDSRRWHAVPVYDASIHYLWVAQVNMLVPRYDVVFTNDPFSKMLFEEYGRGKEVRE
VPLLNRAEFSGTEVRRRIANGEDWRQLVPEHVASVIDAIDGVRRVKMLYAMRGVDMHRHG
YG
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgcatggactacttgtaggaaggttccaaccattccatcttgggcatcttagtgctgtt
gagtatgcattgaagagcatggatatgctctggctagttataggctcagcagataagagc
catgagcctaggaacccattcacagcaggcgagaggttggagatgataaagtatgcattg
gatgcacatggaatagattcaaggagatggcatgcagtgccagtgtatgatgcaagcata
cactacctctgggttgcacaggtgaacatgctcgtgcctagatacgatgttgtcttcaca
aacgatccattcagcaagatgctcttcgaggagtatggaagaggcaaggaggtgagggag
gtgcctctgcttaatagggcagagttctctggcactgaggttaggaggaggattgccaat
ggggaggattggaggcaattagtgccagagcatgttgcatcagttatagatgctattgat
ggtgtgaggagggttaagatgctctatgctatgagaggtgtagatatgcataggcatggt
tatggttag

DBGET integrated database retrieval system