KEGG   Nocardia cyriacigeorgica: NOCYR_0266Help
Entry
NOCYR_0266        CDS       T01756                                 

Definition
(GenBank) putative 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
ncy00071  Fatty acid degradation
ncy00280  Valine, leucine and isoleucine degradation
ncy00281  Geraniol degradation
ncy00310  Lysine degradation
ncy00362  Benzoate degradation
ncy00380  Tryptophan metabolism
ncy00410  beta-Alanine metabolism
ncy00640  Propanoate metabolism
ncy00650  Butanoate metabolism
ncy00903  Limonene and pinene degradation
ncy00930  Caprolactam degradation
ncy01040  Biosynthesis of unsaturated fatty acids
ncy01100  Metabolic pathways
ncy01110  Biosynthesis of secondary metabolites
ncy01120  Microbial metabolism in diverse environments
ncy01130  Biosynthesis of antibiotics
ncy01200  Carbon metabolism
ncy01212  Fatty acid metabolism
Module
ncy_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ncy00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    NOCYR_0266
   00650 Butanoate metabolism
    NOCYR_0266
  Lipid metabolism
   00071 Fatty acid degradation
    NOCYR_0266
   01040 Biosynthesis of unsaturated fatty acids
    NOCYR_0266
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NOCYR_0266
   00310 Lysine degradation
    NOCYR_0266
   00380 Tryptophan metabolism
    NOCYR_0266
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NOCYR_0266
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    NOCYR_0266
   00281 Geraniol degradation
    NOCYR_0266
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NOCYR_0266
   00930 Caprolactam degradation
    NOCYR_0266
Enzymes [BR:ncy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     NOCYR_0266
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     NOCYR_0266
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     NOCYR_0266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 F420_oxidored DUF1843 adh_short_C2 AlaDh_PNT_C NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: CCF61087
UniProt: H6R8Q9
Position
305463..307613
Genome map
AA seq 716 aa AA seqDB search
MSETNMIGWEQDSDGIVVLTMDDPNQGANTMNDLYKKSMTATVERLEAEKDNITGVVLTS
AKKTFFAGGDLKNMMKVTKDDAQQLMDELGEIKGALRRLELLGKPVVAAINGAALGGGLE
IALACHYRIAADVKGSQIGLPEATLGLLPAGGGIIRTVRMLGLQGALMGVLLQGQRNKPA
KAKEIGLVNELVGTVEELIPAAKAWIKANPEGGVQPWDKKGFKIPGGTPSSPAFAANLPA
FPANLRKQIKGANMPAPRAIMAAAVEGSQVDFDNASLIESRYFVNLLTGPVAKNMIQAFF
FDLQSINNGGSRPADVPKREIKKVGVLGAGMMGAGIAYVSAKAGYEVVLKDVTLEAAERG
KGYSEKIEAKALSRGKTTEEKSKALLDRIKPTADAADFAGVDFVIEAVFENTELKHKVFQ
EIEDIVDADALLGSNTSTLPITGLATGVKRQEDFIGIHFFSPVDKMPLVEIIKGEKTSPE
ALARVFDYTLAIKKTPIVVNDSRGFFTSRVIGTFVNEAIAMLGEGIAPATIEQAGLQAGY
PAAPLQLSDELNMKLMLKIAKETEEAIARGEVTMGKERHPAIDVIEFMVNSGRPGRLEKA
GFYDYDENGKRIGLWSGLAEHYKSNIGFGVPIQDLIDRMLFIEAIETQKCFDEGVLETTA
DANIGSIFGIGYPAWTGGVHQFIVGYPGGQEAFVARADELAKTYGARFEVPASLRK
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgagaccaacatgatcggttgggagcaggattcggacggcatcgtcgttttgacg
atggacgacccgaaccagggcgccaacacgatgaacgacctgtacaagaagtcgatgacc
gcgacggtcgagcggctcgaggccgaaaaggacaacatcaccggtgtggtgctgacctcg
gccaagaagaccttcttcgccggtggcgacctgaagaacatgatgaaggtcaccaaggac
gacgcccagcagctgatggacgagctgggcgagatcaagggtgcgctgcgtcgcctcgag
ctgctgggcaagccggtcgtggccgccatcaacggcgccgccctcggcggtggcctggag
atcgcgctggcctgtcactaccgcatcgcggccgacgtcaagggttcgcagatcggtctg
cccgaggccaccctcggcctgctgcccgccggtggcggcatcatccgcaccgtgcgcatg
ctcggcctgcagggcgccctgatgggtgtgctgctgcagggccagcgcaacaagccggcc
aaggccaaggagatcggcctggtcaacgagctggtcggcaccgtcgaggagctgatcccg
gccgccaaggcgtggatcaaggccaaccccgagggtggcgtgcagccgtgggacaagaag
ggcttcaagatccccggcggcaccccgtcctcgccggccttcgccgcgaacctgcctgcc
ttcccggccaacctgcgcaagcagatcaagggcgcgaacatgcctgccccgcgggcgatc
atggccgccgcggtcgagggttcgcaggtcgacttcgacaacgcctcgctgatcgagtcg
cgttacttcgtgaacctgctgaccggcccggtcgccaagaacatgatccaggcgttcttc
ttcgacctgcagtcgatcaacaacggtggttcgcgtccggccgacgtgcccaagcgtgag
atcaagaaggtcggcgtgctgggcgcgggcatgatgggcgccggtatcgcctacgtctcc
gccaaggccggctacgaggtcgtgctcaaggacgtcaccctcgaggccgccgagcgtggc
aagggctactcggagaagatcgaggccaaggccctctcccgtggcaagaccaccgaggag
aagtccaaggcgctgctggaccggatcaagccgaccgcggacgcggccgacttcgccggt
gtcgacttcgtcatcgaggccgtcttcgagaacaccgagctcaagcacaaggtgttccag
gagatcgaggacatcgtcgacgcggacgccctgctgggctccaacacctccaccctgccg
atcaccggtctggcgaccggcgtgaagcgccaggaggacttcatcggcatccacttcttc
tcgccggtcgacaagatgccgctggtggagatcatcaagggtgagaagacctcgcccgag
gcgctggcgcgggtgttcgactacaccctcgcgatcaagaagaccccgattgtcgtcaac
gacagccgcggcttcttcacctcgcgcgtgatcggcaccttcgtcaacgaggcgatcgcc
atgctgggcgagggcatcgcgcccgcgaccatcgagcaggcgggcctgcaggccggctac
ccggccgcgccgctgcagctgtcggatgagctgaacatgaagctcatgctgaagatcgcc
aaggagaccgaagaggccatcgcgcgtggtgaggtcaccatgggcaaggagcgtcacccg
gccatcgacgtcatcgagttcatggtgaactcgggtcgcccgggccgcctggagaaggcc
ggcttctacgactacgacgagaacggcaagcgcatcggtctgtggtccggcctggccgag
cactacaagtcgaacatcggcttcggcgtgccgatccaggatctgatcgaccgcatgctg
ttcatcgaggccatcgagacccagaagtgcttcgacgagggtgtgctggagaccaccgcc
gacgccaacatcggctcgatcttcggtatcggttacccggcctggaccggtggtgtgcac
cagttcatcgtcggttacccgggtggccaggaggccttcgtggctcgcgccgacgagctg
gccaagacctacggcgcgcgtttcgaggttccggcttcgctgcgcaagtag

DBGET integrated database retrieval system