KEGG   Nocardia cyriacigeorgica: NOCYR_1092Help
Entry
NOCYR_1092        CDS       T01756                                 

Gene name
pdhC
Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
ncy00010  Glycolysis / Gluconeogenesis
ncy00020  Citrate cycle (TCA cycle)
ncy00620  Pyruvate metabolism
ncy01100  Metabolic pathways
ncy01110  Biosynthesis of secondary metabolites
ncy01120  Microbial metabolism in diverse environments
ncy01130  Biosynthesis of antibiotics
ncy01200  Carbon metabolism
Module
ncy_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ncy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NOCYR_1092 (pdhC)
   00020 Citrate cycle (TCA cycle)
    NOCYR_1092 (pdhC)
   00620 Pyruvate metabolism
    NOCYR_1092 (pdhC)
Enzymes [BR:ncy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     NOCYR_1092 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2 HlyD_3 HlyD_D23 RnfC_N
Motif
Other DBs
NCBI-ProteinID: CCF61900
UniProt: H6R2Q0
Position
1215753..1217138
Genome map
AA seq 461 aa AA seqDB search
MNEPRADDPNQVLEFRLPDLGEGLTDAELQSWSVAVGDAVELNQTIAEVETAKAVVALPS
PFAGTVVELLVEPGATVPVGAPLIRVRTTAPATPEAPVVTADSAPAKPAEPERTSVLVGY
GPEGEAVSRRRRPAEPVNAAHPQSSAANGKQSTAARAAATPAARKLAKELGIDLWYVAGS
GPQGAVTVDDVRSAVPVSSPRVRAAEPAAAPATTETPAGAESGVVRPPAREERTPISGVR
KRTAAAMVASARTIPQAGASITVDCTASMELLDHLRTTAPFTGLTLTPLALVAKSVLAAL
AEFPGLNAYWDEANQEIVTKHYVNLGIAVATDRGLLVPNIKDAHALSLRDLCREIGWLVD
VARAGNAAPTDLRGGTFTISNVGVFGVDAGMPLVNPGEAAILCLGAITKRPWVVRDELAI
RWVTTLTLSFDHRMIDGEQAARFLATTAGLLEDPLTLLSRL
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgaaccgcgtgccgacgacccgaaccaggtgctggaattccggctgcccgatctg
ggggagggcctgaccgacgccgaactgcaatcgtggtcggtggccgtcggcgacgccgtc
gagctgaatcagaccatcgccgaggtggagacggccaaggcggtggtggcgttgccgtca
ccgttcgcgggcacggtggtggaactgctggtcgagccgggggcgacggtgccggtcggc
gcgccgctgatccgggtgcggaccacggcgcccgccacaccggaggcgcccgtcgtcacg
gcggattccgcgcccgcgaagcccgctgagccggagcgcacgtcggtgctggtcggatac
ggcccggaaggggaggcggtgtcgcggcgacgccgccccgccgagccggtcaacgccgcc
catccgcagagctcggcggcgaacgggaaacagtcgaccgctgcccgcgccgcagcaacc
cccgcagcccggaaactggccaaagagctgggcatcgacctgtggtacgtcgcgggttcc
ggcccgcagggcgcggtcaccgtcgacgacgtccgttcggcggtcccggtctcctcgccg
cgggtccgcgccgccgagcccgccgcagcgcccgccacgaccgagactccggcgggagcc
gaatccggcgtcgtgcgtccgcccgcccgcgaagagcgcacccccatcagcggggtccgc
aaacgcaccgccgccgccatggtcgccagcgcgcgcaccatcccgcaggccggtgcctcg
atcacggtggactgcacggcgagcatggaactgctcgaccatctgcgcaccaccgcgccg
ttcaccggattgacgctgaccccgctggcactggtggcgaaatcggtgctggccgcgctg
gcggaattcccgggcctgaacgcctattgggacgaggcgaatcaggagatcgtcaccaag
cactacgtcaatctcgggatcgcggtggccaccgaccgcggcctgctggtacccaatatc
aaggacgcgcacgcgttgagcctgcgcgatctgtgccgggagatcggctggctggtcgat
gtcgcccgcgcgggcaatgccgcgcccaccgacctgcgcggcggtaccttcaccatctcc
aatgtcggcgtcttcggcgtcgacgccggtatgccgctggtcaatccgggggaggcggcg
atcctgtgcctcggcgcgatcaccaagcgcccctgggtggtgcgcgatgagctcgccatt
cgctgggtcaccacgctgacgctcagtttcgaccaccgcatgatcgacggcgaacaggcc
gcgcggttcctggcgaccacggccgggttgctggaggatccgctcactctgctgagccgt
ttgtag

DBGET integrated database retrieval system