KEGG   Nocardia cyriacigeorgica: NOCYR_1826Help
Entry
NOCYR_1826        CDS       T01756                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01113  alkaline phosphatase D [EC:3.1.3.1]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
ncy00790  Folate biosynthesis
ncy01100  Metabolic pathways
ncy02020  Two-component system
Module
ncy_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ncy00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NOCYR_1826
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NOCYR_1826
Enzymes [BR:ncy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     NOCYR_1826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoD PhoD_N
Motif
Other DBs
NCBI-ProteinID: CCF62612
UniProt: H6RC76
Position
complement(2042147..2043709)
Genome map
AA seq 520 aa AA seqDB search
MVVLRPGNGFSRRALLRTSALGLVAAPALAACSNDTGPALVRQRPTLTHGVAVGDPRSDG
ALLWARSDRPATLIVETAATESFTDAKRFTGPLLTPDSDGTGRLRVSGLPAGELVHYRVT
LEGEDGATSEPLTGVFRTAPLAPADIRLHWSGDVAGQGFGINPDIGGMKIFSTMAARDPH
LFLHSGDVVYADGPLQETVALPDGRVWKNIVTEAKSAVAETLDQYRGQYAYNLSDDNVRR
FNASVAQLVQWDDHETTNNWSPGGTVAADKGYTERDMNVLAARAWQAFHEWNPLDPHEAA
DGRLYRAISYGPLLDVFVLDMRTYKDTNGANTAPDGRIFGPQQTRWLIDGLRASTATWKI
IANDLPLGVVVPDGKTAYEGPANGKAGAPSGRESEIAQVLSAIKRDRVTGVVWLTADVHY
TAAHHYSPERAAFTDFDEFWEFVSGPLNAGAFGPNTLDPTFGPEAVFVHAPPQPNTSPLD
GAYQHFGEVLIDGRSRELTVNLCDANGSVLFSRRLPAPGR
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggttgttctccgccccggcaacggcttctcccggcgcgcactgctgcgcacctccgcg
ctcggcctggtggccgcacccgcgctggcagcgtgttcgaacgacaccgggcccgcactg
gtccggcagcggccgacgctcacccacggcgtcgccgtcggcgatccgcgcagcgacggc
gccctgctctgggcgcggtcggaccgcccggccacgctgatcgtggaaaccgcggccacc
gaatcgttcaccgacgccaaacgattcaccgggccgctgctcacccccgattcggacggc
accgggcgcctgcgggtctccgggctgcccgccggtgaactcgtgcactaccgggtcacc
ctggaaggtgaggacggcgccacctccgaaccgctgaccggcgtcttccgcacggcaccg
ctggcgcccgcagatatccggctgcactggtccggtgacgtcgccggccagggcttcggc
atcaaccccgacatcggcggcatgaagatcttctccaccatggccgcccgcgacccgcat
ctgttcctgcactccggcgacgtcgtctacgccgacggaccattgcaggaaaccgtggcc
ctgcccgacggccgggtctggaagaacatcgtcaccgaggccaagagcgcggtcgcggaa
acgctcgaccagtaccgcggccagtacgcctacaacctctccgacgacaacgtccgccgc
ttcaatgcctcggtcgcgcaactggtccagtgggatgatcacgaaaccaccaacaactgg
tcacccggcggcaccgtcgccgccgacaagggctacaccgagcgggatatgaacgtcctc
gccgcccgcgcctggcaggccttccacgaatggaatccgctcgatccgcacgaggccgcc
gacggcaggctctaccgcgccatctcctacggcccgctactcgacgtcttcgtgctcgat
atgcgcacctacaaagacaccaacggcgccaacaccgcacccgacggccgcatcttcggc
ccgcagcagacccgctggctcatcgacggcctgcgcgcctcaaccgccacctggaagatc
atcgccaacgacctgccgctcggggtggtggtgccggacggcaagaccgcctacgagggc
cccgccaacggcaaggccggcgcgccgtccggtcgcgaatccgagatcgcccaggtgctc
tcggccatcaaacgcgatcgggtgaccggcgtcgtgtggctgaccgccgacgtccactac
accgccgcccaccactactcccccgagcgggcggcgttcaccgacttcgacgagttctgg
gaattcgtctccggaccgctcaacgccggcgcattcggacccaacaccctcgaccccacc
ttcgggccggaagcggtgttcgtgcacgccccgccgcagcccaatacctccccgctcgac
ggcgcctaccagcatttcggcgaggtgctgatcgacggccggtcaagggagctgacggtg
aatctgtgcgacgcgaacggatcggtgctgttcagccgacggctgcccgcgccgggccgg
tga

DBGET integrated database retrieval system