KEGG   Nocardia cyriacigeorgica: NOCYR_2020Help
Entry
NOCYR_2020        CDS       T01756                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
ncy00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ncy01100  Metabolic pathways
ncy01110  Biosynthesis of secondary metabolites
ncy01130  Biosynthesis of antibiotics
ncy01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ncy00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NOCYR_2020 (trpC)
Enzymes [BR:ncy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     NOCYR_2020 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh OMPdecase QRPTase_C
Motif
Other DBs
NCBI-ProteinID: CCF62805
UniProt: H6QZ51
Position
2252818..2253636
Genome map
AA seq 272 aa AA seqDB search
MTVLDSILDGVRADVAARESLLDFQAIKAAAAAAPPPKDALAALHEDGIGVIAEVKRASP
SKGALAEIADPASLAKAYEDGGARIISVLTEGRRFHGSLDDLDAVRAAVNIPVLRKDFVV
GPYQIHEARAHGADVILLIVAALEQDTLSSLIDRTESLGMTALVEVHTEEEADRALNAGA
SVVGINARNLKTLEVDRDCFARIAPGLPTEVIRVAESGVRGTADLMAYAGAGADAVLVGE
GLVTSGDPRAAVSQLVTAGTHPSCPKPARRTR
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgacggtactcgactcgattctcgacggggtccgcgcggatgtggccgcacgggaatcc
ctgctggacttccaagccatcaaggccgcggccgccgccgcgccgccgccgaaggacgcg
ctcgccgcgctgcatgaagacggcatcggcgtcatcgccgaggtgaagcgggccagcccc
tccaagggagcgctcgccgagatcgccgaccccgccagcctggccaaggcctacgaagac
ggcggcgcccgcatcatcagcgtgctcaccgagggccgtcgcttccacggctcgctcgac
gacctcgacgccgtccgtgccgccgtgaacatcccggtgctgcgcaaggacttcgtggtc
gggccgtaccagatccacgaggcgcgcgcgcacggcgccgacgtcatcctgctgatcgtc
gccgcgctggaacaggacaccctgagctcgctcatcgaccgcaccgaatcgctcggcatg
accgcgctggtcgaggtgcacaccgaagaagaggccgaccgggcgctcaacgccggtgcc
tcggtcgtcggcatcaacgcccgcaacctcaagaccctggaagtcgaccgcgactgcttc
gcgcggatcgcgcccggcctgcccaccgaggtcatccgggtcgccgagtccggcgtgcgt
ggcaccgccgacctgatggcctacgccggcgcgggcgcggacgccgtgctcgtcggcgag
ggcctggtgaccagcggcgacccgcgcgcggcggtctcccagctggtgaccgcgggtacc
cacccgtcctgcccgaagcccgcccggcggacccgctga

DBGET integrated database retrieval system