KEGG   Nocardia cyriacigeorgica: NOCYR_2472Help
Entry
NOCYR_2472        CDS       T01756                                 

Definition
(GenBank) putative carnitinyl-CoA dehydratase (Crotonobetainyl-CoA hydratase) (modular protein)
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
ncy00071  Fatty acid degradation
ncy00072  Synthesis and degradation of ketone bodies
ncy00280  Valine, leucine and isoleucine degradation
ncy00310  Lysine degradation
ncy00362  Benzoate degradation
ncy00380  Tryptophan metabolism
ncy00620  Pyruvate metabolism
ncy00630  Glyoxylate and dicarboxylate metabolism
ncy00640  Propanoate metabolism
ncy00650  Butanoate metabolism
ncy00900  Terpenoid backbone biosynthesis
ncy01100  Metabolic pathways
ncy01110  Biosynthesis of secondary metabolites
ncy01120  Microbial metabolism in diverse environments
ncy01130  Biosynthesis of antibiotics
ncy01200  Carbon metabolism
ncy01212  Fatty acid metabolism
ncy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ncy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NOCYR_2472
   00630 Glyoxylate and dicarboxylate metabolism
    NOCYR_2472
   00640 Propanoate metabolism
    NOCYR_2472
   00650 Butanoate metabolism
    NOCYR_2472
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NOCYR_2472
   00072 Synthesis and degradation of ketone bodies
    NOCYR_2472
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NOCYR_2472
   00310 Lysine degradation
    NOCYR_2472
   00380 Tryptophan metabolism
    NOCYR_2472
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NOCYR_2472
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NOCYR_2472
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NOCYR_2472
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ncy04147]
    NOCYR_2472
Enzymes [BR:ncy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     NOCYR_2472
Exosome [BR:ncy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NOCYR_2472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Polyketide_cyc2
Motif
Other DBs
NCBI-ProteinID: CCF63243
UniProt: H6R3T7
Position
complement(2721993..2724950)
Genome map
AA seq 985 aa AA seqDB search
MGGVPRVLKQARNQVRAVRQLTAAVIGNPRILRDLAAGAFGGADSATTEPADTGHEPPAG
LAEFDKRAHAATHLDADAETVAAYLTDPGRFPDWLSMHAAFRGETPAGAYAGLEFAQQVK
FMGLPADIAWTVTSAEPTAIALRGRGPMGLRLGFWLTIYSEGAGSLVCFDAGLSGQPVDG
PLGASLVRTLSEALRESLDRLPDQIATAGPLPARRAVRTPVVHAASGRTLAPNTPVLVGA
GQFVSHTPDPAADPATLAARALRLAAADAGAPENVLAGAQAIFSVASASWQYRDMGALVA
EAVGARSVDTVQSSRYGGDGGQLLINEAAQAIAEGTYEMVLVTGAEAGATLAAAQRSGAE
IAWPEQGPEAAPIRTAGIDREPNNAAEIAAGLGAPIYMYALMESANRHRLGREPKQHLRA
IGELWSRMSAIGARNPNAWLPQEFTADELTTPTDDNRMVSAPYTKLLCANLQVDMAAGLV
LCSVAAAEAAGIAQDKWVFVHAGASAHDEWFVSERTELAASPAIRTIGAAVLEHAGIGID
QVGPVDLYSCFPVAVQIAARELGLTVDDPQRPLSVTGGLTFGGGPGNNYGTHAVATMVEQ
LRANPETFGLSTSLGWYVTKHAIGIYSATPPRQAYAHLRPIVDHPPARPVRQSYEGPAVV
EAYTLPYDRDGDPEAAILSLITPDGARVLLRNKDSGLIDLLTDGDGLGLPVSVRGEQISI
EGDRPVELPAAPPPPVRVERRGPIMIITLNRPEVRNAVNHAMAVAVERACDAFEADPALR
VAILTGADGYFSSGMDLAAMTKGEAPLTEGRGTLGLTGKPPKKPLIAAVEGPALAGGCEL
ALAADLIVAARDAQFGIPEPKRGLIAAAGGVMRLRERLPRNVAMELALTGDPMPATRLAE
FGLVNVLAEPGDALTAALALAERIAANAPLSVIGSKRIIEEAADWASDDAYERQYEIAAT
ALSSEDAAEGVRAFTEKREPIWKGR
NT seq 2958 nt NT seq  +upstreamnt  +downstreamnt
gtgggcggtgttccccgcgtgctgaagcaggcgcgcaaccaggtgcgggcggtacggcag
ctcaccgccgccgtcatcggcaatccgcgcatcctgcgcgacctcgcggccggcgcgttc
ggcggtgcggattccgcgaccaccgagcctgccgacaccggccatgagccgcccgccggt
ctcgcggaattcgacaaacgcgcccatgccgccacccacctcgatgccgacgcggagacg
gtcgcggcctatctcaccgatcccggccgcttccccgactggctcagcatgcacgccgcc
ttccggggcgagacgcccgccggtgcgtacgccgggctggagttcgcccagcaggtgaag
ttcatggggctgcccgccgatatcgcgtggacggtcacctcggccgaacccaccgcgatc
gccctgcgcggccgcgggccgatggggctgaggctcgggttctggctcacgatctattcc
gagggcgcaggctcgctggtctgcttcgacgcgggactgtccgggcaacccgtcgacggc
ccgctgggcgcctcgctggtgcgcacattgtcggaggcgctgcgcgaatcgctcgaccgc
ctgcccgaccagatcgcgacggcaggcccactccccgctcgccgcgccgtacgcacacct
gtcgtacacgcggcgtcggggcgaactctggcaccgaataccccggtcctggtcggtgcg
ggccaattcgtctcgcacaccccggatcccgccgccgacccggccacgctggcggcccgg
gcgctacgcctggccgccgccgacgccggagcaccggagaatgtgctcgccggcgcccag
gcgatcttctcggtggccagcgcctcctggcagtaccgggatatgggggcgctggtcgcc
gaggcagtcggcgcgcgaagcgtcgataccgtccaatcgtcgcgctacggcggcgacggc
ggtcagctgctgatcaacgaagcggcccaagccattgccgagggcacctacgagatggtg
ctggtcaccggcgccgaagccggtgccactttggcggccgcgcaacgctccggcgccgag
atcgcctggccggagcagggccccgaggcggcaccgattcgaacggcgggtatcgaccgc
gaacccaacaacgccgccgagatcgccgcgggcctgggcgcgccgatctacatgtacgcc
ctcatggaatcggcgaatcggcatcggctcggccgcgaacccaagcagcatctgcgcgcg
atcggcgagctgtggtcgcgcatgtcggccatcggcgcacgcaatccgaatgcctggctg
ccccaggaattcaccgccgacgagctgaccacccccaccgacgacaaccggatggtgtcg
gcgccctacaccaagctgctgtgcgccaatctccaggtggatatggccgcgggcctggtg
ctgtgcagtgtcgcggcggccgaggcggcgggcatcgcgcaggacaagtgggtgttcgtg
cacgccggagcatcggcgcacgacgagtggtttgtctccgagcgcacggaactggccgcg
tcaccggcgatccgcaccatcggcgcggcggtcctcgagcacgcggggatcgggatcgac
caggtcgggccggtcgacctgtactcgtgcttcccggtggcggtgcaaatcgcggcccgg
gaactcggtctcacggtggacgatccgcagcgtccgctgtcggtgacgggcgggctgacc
ttcggcggcgggccgggcaacaactacggcacgcatgcggtcgccacgatggtcgagcag
ttgcgcgcgaatcccgaaacgttcgggctgagtacctcgctcggctggtatgtcaccaag
cacgcgatcggcatctactccgcgacaccgccgcgtcaggcgtacgcgcacctgcggccg
atcgtcgatcatccacccgcgcgcccggtccgtcagagctacgaagggcccgccgtggtc
gaggcctacacgctgccctatgaccgcgatggtgacccggaagccgccatcctgagcctc
atcacgcccgacggcgctcgagtactgctgcgcaacaaggactccgggctgatcgacctc
ctcaccgacggcgatgggctcggactgccggtctcggtgcggggtgagcagatcagcatc
gagggtgatcgcccggtcgagctgcccgctgctcccccgccgcccgtgcgggtcgagcgg
cgcggaccgatcatgatcatcacactgaaccggcccgaggtccgcaatgccgtcaaccac
gccatggccgtcgccgtggaacgggcttgcgatgcgttcgaggccgaccctgccctgcgg
gtcgcgattctcaccggtgccgacggctatttcagttccggcatggacttggccgccatg
accaagggcgaagcgccgctgaccgaaggccgtgggacgctgggacttacgggtaaaccg
cccaagaagccgctcatcgccgccgtcgagggtccggcgctggcgggtggttgtgaactc
gcgctggccgcggacttgatcgtggcggcgcgcgacgcgcagttcggtattcccgaaccc
aaacgcgggctgatcgcggccgcgggcggtgtcatgcggttgcgggaacggttgccccgc
aatgtcgccatggaactcgcgctcaccggcgacccgatgcccgccacccggctggccgaa
ttcggcctggtcaacgtgctcgccgaaccgggcgatgcattgacggccgcactcgccctg
gccgagcggatcgccgccaacgcgccgctgagcgtcatcggcagcaaacgcatcatcgag
gaagccgcggactgggcctccgacgacgcctacgaacggcaatacgagatcgccgccacc
gccctgtcctccgaggacgcggccgagggcgtgcgggcgttcaccgagaaacgcgaaccg
atctggaagggccggtga

DBGET integrated database retrieval system