KEGG   Nocardia cyriacigeorgica: NOCYR_3703Help
Entry
NOCYR_3703        CDS       T01756                                 

Gene name
hdhA
Definition
(GenBank) 7-alpha-hydroxysteroid dehydrogenase (7-alpha-HSDH)
  KO
K00076  7-alpha-hydroxysteroid dehydrogenase [EC:1.1.1.159]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
ncy00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:ncy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    NOCYR_3703 (hdhA)
Enzymes [BR:ncy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.159  7alpha-hydroxysteroid dehydrogenase
     NOCYR_3703 (hdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR F420_oxidored Epimerase Shikimate_DH 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: CCF64466
UniProt: H6R367
Position
4089683..4090474
Genome map
AA seq 263 aa AA seqDB search
MILDRFRLDDRVAIVTGAGRGLGAAIAVGFAEAGADVVIAARTESDLRSVAAQVEATGRK
AHVVVADLADLDAVAALADAAVTQFGRLDIVVNNVGGAMPKPLLDTSAAELSEAFTFNVG
TAHTLVRAAAPKILETAGTGSIINITSTMGRLPGRAFAAYATAKAALAHYTRSAAMDLCP
RIRVNAIAPGSILTSALEVVAGNEQMRTALEQATPMRRLGNPADIASAALFLASPAGEFL
TGKVLEVDGGLIAPNLDIPIPDL
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgattctggatcgattccggctcgatgaccgggtagcgatcgtcaccggcgccgggcga
ggcctcggtgccgcgatagccgtcggattcgccgaggcgggcgccgatgtggtgatcgcg
gcgcgcaccgaatccgatctgcggtcggtcgccgcccaggtggaggcgaccgggcgcaag
gcccatgtggtggtcgccgatctcgccgatctcgatgcggtggcggcgctggccgacgcg
gccgtcacgcagttcggccggctcgacatcgtggtcaacaatgtcggcggggcgatgccg
aaaccgctgctggacaccagcgctgccgaactgtcggaggcgttcaccttcaatgtcggt
accgcgcacaccctggtgcgcgccgccgcgccgaagatcctggagacggcgggcaccggc
tcgatcatcaacatcacctcgacgatgggccggctgcccggccgcgccttcgccgcctac
gccaccgcgaaagccgcgctcgcgcattacacccgcagcgccgccatggacctgtgccca
cgcatccgggtgaacgcgatcgcccccggatccatcctcacctccgcactggaggtcgtg
gccggcaacgagcagatgcgcacggcgctggaacaggccaccccgatgcgccgcctgggc
aacccggccgatatcgcctcggccgcactgtttctcgcctcgcccgcgggtgagttcctg
accggcaaggtgctcgaggtcgacggcggcctcatcgcaccgaatctcgatatccccatc
ccggatctgtga

DBGET integrated database retrieval system