KEGG   Nocardia cyriacigeorgica: NOCYR_4627Help
Entry
NOCYR_4627        CDS       T01756                                 

Gene name
fadA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
ncy00071  Fatty acid degradation
ncy00072  Synthesis and degradation of ketone bodies
ncy00280  Valine, leucine and isoleucine degradation
ncy00310  Lysine degradation
ncy00362  Benzoate degradation
ncy00380  Tryptophan metabolism
ncy00620  Pyruvate metabolism
ncy00630  Glyoxylate and dicarboxylate metabolism
ncy00640  Propanoate metabolism
ncy00650  Butanoate metabolism
ncy00900  Terpenoid backbone biosynthesis
ncy01100  Metabolic pathways
ncy01110  Biosynthesis of secondary metabolites
ncy01120  Microbial metabolism in diverse environments
ncy01130  Biosynthesis of antibiotics
ncy01200  Carbon metabolism
ncy01212  Fatty acid metabolism
ncy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ncy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NOCYR_4627 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    NOCYR_4627 (fadA)
   00640 Propanoate metabolism
    NOCYR_4627 (fadA)
   00650 Butanoate metabolism
    NOCYR_4627 (fadA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NOCYR_4627 (fadA)
   00072 Synthesis and degradation of ketone bodies
    NOCYR_4627 (fadA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NOCYR_4627 (fadA)
   00310 Lysine degradation
    NOCYR_4627 (fadA)
   00380 Tryptophan metabolism
    NOCYR_4627 (fadA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NOCYR_4627 (fadA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NOCYR_4627 (fadA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NOCYR_4627 (fadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ncy04147]
    NOCYR_4627 (fadA)
Enzymes [BR:ncy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     NOCYR_4627 (fadA)
Exosome [BR:ncy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NOCYR_4627 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Dodecin
Motif
Other DBs
NCBI-ProteinID: CCF65382
UniProt: H6QZM0
Position
5088828..5090048
Genome map
AA seq 406 aa AA seqDB search
MPEAVIVSYARSPIGRAGKGSLVSMRPDDLATQMVRAALDKVPALDPAQIDDLMLGCGQP
GGEAGFNMAKVVATQLGYDFLPGVTLNRYCSSSLQTTRMALHAIKAGEGDVFISAGVETV
SRFPKGTSDGWPDTHNEKFAEAEARTVKRAEGGSDGWADPRESGELPDVYIAMGQTAENV
AQYTGISREDQDHWGVRSQNRAEEAIKAGFFEREITPVTLPDGTVVSTDDGPRPGTTYEK
ISQLKPVFRPDGTVTAGNACPLNDGAAALVIMSDTKAKELGLTPLARIVSTGVSGLSPEI
MGLGPIEAVRKALKIAGKTIDDIDLYEINEAFAVQVLGSARELNMDLDRLNVSGGAIALG
HPFGMTGARITATLINNLQTHDKQFGLETMCVGGGQGMAMIIERLS
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaggccgtcatcgtttcgtacgcccgctcccccatcggccgcgcaggcaagggt
tctctggtgagcatgcggccggacgacctcgccacccagatggtccgcgccgccctcgac
aaggtccccgcgctcgacccggcccagatcgacgatctgatgctcggctgcggccagccc
ggcggcgaggccggcttcaacatggccaaggtggtggccacccagctcggctacgacttc
ctgcccggcgtgaccctcaaccggtactgttcgtcgtcgctgcagaccacccgcatggcg
ctgcacgccatcaaggccggtgagggcgatgtgttcatctccgccggtgtggagaccgtc
tcgcgcttcccgaagggcacctccgacggctggcccgacacccacaacgagaagttcgcc
gaggccgaggcgcgcaccgtcaagcgcgccgagggcggctccgacggctgggccgacccg
cgcgagagcggcgagctgcccgacgtctacatcgcgatgggccagaccgccgagaacgtc
gcccagtacaccggcatctcgcgcgaggaccaggaccactggggcgtgcgttcgcagaac
cgcgccgaggaggccatcaaggccggcttcttcgagcgggagatcactccggtcaccctg
cccgacggcaccgtggtctccaccgacgacggcccccgccccggcaccacctacgagaag
atctcgcagctcaagccggtcttccgccccgacggcaccgtcaccgccggtaacgcctgc
ccgctcaacgacggcgccgccgccctggtgatcatgagcgacaccaaggccaaggagctg
ggcctgaccccgctggcccgcatcgtctccaccggtgtgtccggtctgtcgccggagatc
atgggcctcggcccgatcgaggccgtccgcaaggcgctgaagatcgccggcaagaccatc
gacgacatcgacctctacgagatcaacgaggccttcgcggtgcaggtgctcggctcggcc
cgcgagctgaacatggacctggaccggctcaacgtctccggcggcgccatcgccctcggc
cacccgttcggcatgaccggcgcccgcatcaccgcgacgctgatcaacaacctccagacc
cacgacaagcagttcggcctggagaccatgtgcgtcggcggcggccaaggcatggccatg
atcatcgagcgcctcagctga

DBGET integrated database retrieval system