KEGG   Nocardia cyriacigeorgica: NOCYR_4761Help
Entry
NOCYR_4761        CDS       T01756                                 

Gene name
sucC
Definition
(GenBank) Succinyl-CoA ligase [ADP-forming] subunit beta (Succinyl-CoA synthetase subunit beta) (SCS-beta)
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
ncy00020  Citrate cycle (TCA cycle)
ncy00640  Propanoate metabolism
ncy00660  C5-Branched dibasic acid metabolism
ncy01100  Metabolic pathways
ncy01110  Biosynthesis of secondary metabolites
ncy01120  Microbial metabolism in diverse environments
ncy01130  Biosynthesis of antibiotics
ncy01200  Carbon metabolism
Module
ncy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ncy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ncy00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NOCYR_4761 (sucC)
   00640 Propanoate metabolism
    NOCYR_4761 (sucC)
   00660 C5-Branched dibasic acid metabolism
    NOCYR_4761 (sucC)
Enzymes [BR:ncy01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     NOCYR_4761 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A
Motif
Other DBs
NCBI-ProteinID: CCF65515
UniProt: H6R1D6
Position
complement(5254608..5255774)
Genome map
AA seq 388 aa AA seqDB search
MDLFEYQAKELFVKHGVPSSEGRVTDTAEDARAIAQEIGKPVMIKSQVKVGGRGKAGGVK
YAATPEDAFTHASNILGLDIKGHITKKILVAEAKDIAEEYYISFLLDRSNRTYLAMCSVE
GGMEIEEVAATKPDRLAKVPVDAVKGVDLAFARSIAEQGHLPAEVLDAAAVTIQKLWEVF
VAEDATLVEVNPLVRTPQDEILALDGKVTLDENADFRQPGHAEFADKDATDPLELKAKEN
DLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGEKHDGVKPANFLDIGGGASAEVMAAGLD
VILNDAQVKSVFVNVFGGITACDAVANGIVKALEILGSEANKPLVVRLDGNRVEEGRKIL
ADAAHPLVTLAQTMDEGADKAAELAAAK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggatctcttcgaatatcaggcgaaggagctcttcgttaagcacggagtgccttcgtcg
gagggccgcgtgacggacacggccgaggatgcccgcgccatcgcgcaggaaatcggcaag
ccggtgatgatcaagtcccaggtgaaggtcggcggccgtggcaaggcaggcggcgtgaag
tacgccgccaccccggaagacgccttcacgcacgcgtcgaacattctcggcctcgacatc
aagggccacatcaccaagaagatccttgtcgccgaagccaaggacatcgcggaggagtac
tacatctccttcctgctggatcgctccaaccgcacctacctggccatgtgctcggtcgag
ggcggcatggagatcgaagaggtcgcggccaccaagcccgaccgcctggccaaggttccg
gtcgacgccgtcaagggtgtcgacctggccttcgcgcgttccatcgccgagcagggccac
ctgcccgccgaggtgctcgacgccgcggccgtgaccatccagaagctgtgggaggtcttc
gtcgccgaagacgccaccctggtcgaggtcaacccgctggtgcgcaccccgcaggacgag
atcctcgccctcgacggcaaggtcaccctggacgagaacgccgacttccgccagcccggc
cacgcggagttcgcggacaaggacgcgaccgacccgctggagctcaaggccaaggagaac
gacctcaactacgtcaagctcgacggtgaggtcggcatcatcggcaacggcgccggtctg
gtcatgtcgaccctcgacgtggtcgcctacgcgggcgagaagcacgacggggtcaagccg
gccaacttcctcgacatcggtggcggcgcctcggccgaggtgatggcggccgggctggac
gtcatcctgaacgacgcccaggtcaagagcgtgttcgtcaacgtcttcggtggtatcacc
gcctgtgacgcggtggccaacggcatcgtcaaggcgctggagatcctgggctcggaggcg
aacaagccgctggtcgtgcggctggacggcaaccgcgtggaggagggtcgcaagatcctc
gccgacgccgcgcacccgctggtgacgctggcgcagacaatggacgaaggcgccgacaag
gccgccgaactggctgccgccaaataa

DBGET integrated database retrieval system