KEGG   Nocardia cyriacigeorgica: NOCYR_4994Help
Entry
NOCYR_4994        CDS       T01756                                 

Definition
(GenBank) putative sugar kinase, Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
ncy00010  Glycolysis / Gluconeogenesis
ncy00052  Galactose metabolism
ncy00500  Starch and sucrose metabolism
ncy00520  Amino sugar and nucleotide sugar metabolism
ncy00521  Streptomycin biosynthesis
ncy01100  Metabolic pathways
ncy01110  Biosynthesis of secondary metabolites
ncy01120  Microbial metabolism in diverse environments
ncy01130  Biosynthesis of antibiotics
ncy01200  Carbon metabolism
Module
ncy_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ncy_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ncy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NOCYR_4994
   00052 Galactose metabolism
    NOCYR_4994
   00500 Starch and sucrose metabolism
    NOCYR_4994
   00520 Amino sugar and nucleotide sugar metabolism
    NOCYR_4994
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NOCYR_4994
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    NOCYR_4994
Enzymes [BR:ncy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     NOCYR_4994
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FGGY_N
Motif
Other DBs
NCBI-ProteinID: CCF65745
UniProt: H6R3E7
Position
complement(5583258..5584154)
Genome map
AA seq 298 aa AA seqDB search
MAVLALDIGATKFAAGVVDERGRVTGVRRVAVPESGVWEACRGLLVEVAAGEAVSAVGVG
SAGPVDVPAGIAGPLNIPEWREGFAIVDAVGALFPGAAVRFAIDGACLALAEHHSGALRG
VPNALAMTVSSGIGGGLLVDGRVASGRTGNAGHIGHIVVPGWDVPCACGGFGCVEAVASG
MSSARWAREQGWTGANGAELARAAAAGDRIALAALERAGTALGQAVSSAAALLDVDTVVI
GGGFAHSGEPLWGPMRAAITRHAGLNFIRDLRVHLSTLADGATLVGAAILAADLPAVG
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
gtggcggtgctggcgctcgatatcggggcgacgaagttcgcggcgggggtcgtcgacgag
cggggacgggtgacgggggtgcggcgggttgcggtgccggagtcgggggtgtgggaggcg
tgccgggggctgttggtcgaggtcgcggcgggagaggcggtgagtgcggtcggggtcgga
tcggcggggccggtggatgtgcctgcggggatcgccgggccgttgaatattccggagtgg
cgggaagggttcgccatcgttgacgcggtcggtgcgctgtttcccggtgccgcagtgcga
ttcgccatcgacggcgcgtgtctggcgctggccgaacatcattcgggtgcgttgcgcggt
gtgccgaacgcactggcgatgacggtctcgtccgggatcggtggcgggctgctggtcgac
ggtcgcgtcgcttccggccggaccggcaacgcgggccacatcgggcacatcgttgttccg
ggctgggatgtgccgtgtgcctgcggtggtttcgggtgcgtcgaggcggtcgcgagtggg
atgtcgtcggcgcggtgggccagggagcaggggtggaccggtgcgaacggggcggagctg
gcgcgggcggccgcggccggcgaccggatcgcgctcgcggcgctggaacgggccgggacc
gcgctcgggcaggccgtcagttcggcggcggcgctgctggacgtcgacaccgtcgtcatc
ggcggcggcttcgcgcattccggcgaaccgctgtggggcccgatgcgcgcggccatcacc
cggcatgcgggactgaacttcatccgcgatctgcgggtgcacctgtcgacgctcgccgac
ggcgccaccctcgtcggcgccgccatcctcgcggcggatctgcccgcagtcggctga

DBGET integrated database retrieval system