KEGG   Nocardiopsis dassonvillei: Ndas_0429Help
Entry
Ndas_0429         CDS       T01248                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
nda  Nocardiopsis dassonvillei
Pathway
nda00010  Glycolysis / Gluconeogenesis
nda00620  Pyruvate metabolism
nda00640  Propanoate metabolism
nda00680  Methane metabolism
nda01100  Metabolic pathways
nda01110  Biosynthesis of secondary metabolites
nda01120  Microbial metabolism in diverse environments
nda01130  Biosynthesis of antibiotics
nda01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ndas_0429
   00620 Pyruvate metabolism
    Ndas_0429
   00640 Propanoate metabolism
    Ndas_0429
  Energy metabolism
   00680 Methane metabolism
    Ndas_0429
Enzymes [BR:nda01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Ndas_0429
Lipid biosynthesis proteins [BR:nda01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Ndas_0429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ADH65876
UniProt: D7AWB0
Position
1:complement(519424..521142)
Genome map
AA seq 572 aa AA seqDB search
MSRETAAAGAAEFRAARDLLLDLREDQGRAHREFTWPRSDRFNWALDYFDEVAGRRPDRT
ALWIVEEDGGQARYTYRRMSERSAQVANWLNNQGVHPGDRILLMLGNQVELWETLLAATK
LGAVVCPTPTSLSEGDLLDRLERGEIAHVVCSAAETEKFAPLRGHWTRICTGYMEGWLNY
ADSEHAGLDFHPPHTTHPDDPLLLYFTSGTATLPKLVVHTQRSYPVGHLSTMYWLGVRPG
DVHLNVSEPGWAKHAYGSVFAPWNAEATVLVVNQERFDAAGLLDAIVRCGVDTLCAPPTV
WRTLAQADPAAWDVGLREAVAAGEPLNPEVVDRVREAWGVTVRDGFGQTETTVLLGNGPG
QRVVRGSMGREMPGYDVVLTDPATDEPADTGQICVDLAREPVGVMKGYADNPGLSREVVR
GDRYRTGDIASRDSNGYITYIGRSDDVFKASDYRISPFELESVLVEHEYVVEAAVVPSPD
PLRLAVAKAYVALAEGVAPDAETARSILAHARERLSPHQRVRRLEFGELPKTVSGKIRRV
QLRRAEAERGTVADGARNPREYWEEDLPGLER
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagagagacggcagccgcgggcgcggccgagttccgcgccgcccgggacctgctc
ctggacctgcgcgaggaccaggggagggcgcaccgggagttcacctggccccggtcggac
cggttcaactgggcgctggactacttcgacgaggtggccgggcgccgtccggaccggacg
gcgctgtggatcgtggaggaggacggcggccaggccaggtacacctaccggcggatgtcg
gagcgctccgcccaggtggccaactggctgaacaaccagggcgtgcacccgggcgaccgg
atcctgctgatgctgggcaaccaggtggagctgtgggagaccctgctcgccgcgaccaag
ctcggcgccgtggtctgccccacccccacctccctgtccgagggcgacctgctggaccgg
ctggagcgcggcgagatcgcgcacgtggtgtgctcggccgccgagaccgagaagttcgcc
ccgctgcgggggcactggacgcggatctgcacgggctacatggaggggtggctgaactac
gccgactccgagcacgccggtctggacttccaccccccgcacaccacccaccccgacgac
cccctgctgctgtacttcacctccggcaccgccaccctgcccaagctggtcgtgcacacc
cagcgctcgtacccggtggggcacctgtcgaccatgtactggctgggtgtgcggccgggc
gacgtccacctcaacgtgtccgagccggggtgggccaagcacgcctacggcagcgtgttc
gcgccgtggaacgccgaggcgacggtgctggtcgtcaaccaggagcgcttcgacgcggcg
gggctgctggacgcgatcgtgcgctgcggggtggacacgctgtgcgcgccgccgacggtg
tggcggactctggcgcaggccgaccccgccgcgtgggacgtggggctgcgcgaggcggtg
gccgccggggagccgctcaaccccgaggtggtggaccgcgtgcgcgaggcatggggcgtg
accgtgcgcgacgggttcgggcagaccgagacgaccgtactgctgggcaacggccccggt
cagcgcgtggtgcgcgggtcgatggggcgggagatgccgggctacgacgtggtgctgacg
gacccggccaccgacgagcccgccgacaccgggcagatctgcgtggacctggcccgggag
ccggtgggggtgatgaaaggctacgccgacaaccccggcctcagccgcgaggtggtccgc
ggggaccgctaccgcaccggtgacatcgccagccgggattcgaacggttacattacctat
atcggtcgatccgacgatgtgttcaaggcctcagattaccgcatctcaccattcgaactc
gaaagcgttctggtcgagcacgaatacgtggtcgaggcggccgtcgttccctcccccgac
ccgctgcggctggcggtggccaaggcgtacgtggccctggccgagggggtggcccccgac
gccgagaccgcgcggtcgatcctggcccacgcgcgcgagcgcctgtcaccgcaccagagg
gttcgccgcctggagttcggtgagctgcccaagaccgtctccggtaagatccgtcgcgtg
cagctgcgtcgggccgaggccgagcgcggcacggtcgccgacggcgcgcgcaacccgcgc
gagtactgggaggaggacctcccggggttggagcggtga

DBGET integrated database retrieval system