KEGG   Nocardiopsis dassonvillei: Ndas_2624Help
Entry
Ndas_2624         CDS       T01248                                 

Definition
(GenBank) 4-hydroxythreonine-4-phosphate dehydrogenase
  KO
K22024  4-phospho-D-threonate 3-dehydrogenase / 4-phospho-D-erythronate 3-dehydrogenase [EC:1.1.1.408 1.1.1.409]
Organism
nda  Nocardiopsis dassonvillei
Brite
KEGG Orthology (KO) [BR:nda00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Ndas_2624
Enzymes [BR:nda01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.408  4-phospho-D-threonate 3-dehydrogenase
     Ndas_2624
    1.1.1.409  4-phospho-D-erythronate 3-dehydrogenase
     Ndas_2624
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PdxA DUF3606
Motif
Other DBs
NCBI-ProteinID: ADH68041
UniProt: D7AYM9
Position
1:3130122..3131150
Genome map
AA seq 342 aa AA seqDB search
MSRPTLAVTLGDVAGIGPEITAKALLHHPEVREYAKPVVVGDADALRNAVAAVGGDPEAV
NTVASPAEAADEPGVIDVVQTGPSLGHVPPGELSAEAGDGAARFVIAAVDLAKRGLVEGI
VTPPLNKAAMHLGGHAWPGHTELLAHEFGVKDYSLVLSADELSFFHLTTHVSLRQAIEGV
TQERTLQVLRLMSAFARAQGSPDEPIGVAGLNPHAGENRLFGDEDADVLAPAIARAREEG
INAHGPLPADALIPAAVKGKWKLVAVCYHDQGHAPFKAVYGDDGVNITAGLPVVRVSVDH
GTAFDIAGRGIAREASLVLAIRRAAELAPGWGHVWQATRSEG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtcccacactggcagtcaccctgggcgacgtggcggggatcggccccgagatc
acggccaaggcgctgctgcaccaccccgaggtccgcgagtacgccaagccggtcgtggtc
ggtgacgccgacgcgctgcgcaacgccgtcgccgccgtcggcggggacccggaggcggtc
aacaccgtcgcctccccggccgaggccgccgacgagcccggcgtgatcgacgtcgtgcag
accggcccctcgctgggccacgtccccccgggcgagctgagcgcggaggcgggcgacggg
gcggcccggttcgtcatcgccgccgtggacctggccaagcgcggcctggtggagggcatc
gtcaccccgccgctgaacaaggccgcgatgcacctgggcggccacgcctggcccgggcac
accgagctgctcgcgcacgagttcggggtgaaggactacagcctggtgctgtcggcggac
gagctgtccttcttccacctgaccacgcacgtgtcgctgcgccaggccatcgagggcgtc
acccaggagcgcaccctccaggtgctgcgcctgatgagcgccttcgcccgcgcccagggc
agcccggacgagcccatcggggtggcgggcctgaacccgcacgcgggcgagaaccgcctg
ttcggcgacgaggacgccgacgtcctggcgcccgcgatcgcccgcgcccgcgaggagggc
atcaacgcccacggcccgctcccggccgacgccctgatcccggcggcggtcaagggcaag
tggaagctggtcgcggtctgctaccacgaccaggggcacgcgcccttcaaggcggtctac
ggggacgacggggtcaacatcaccgcgggcctgccggtggtgcgcgtctcggtcgaccac
ggcacggccttcgacatcgcgggccggggcatcgcccgcgaggccagcctcgtgctggcg
atccgccgcgcggccgagctggcccccggctggggccacgtctggcaggccacccgctcc
gaggggtag

DBGET integrated database retrieval system