KEGG   Nocardiopsis dassonvillei: Ndas_2828Help
Entry
Ndas_2828         CDS       T01248                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
nda  Nocardiopsis dassonvillei
Pathway
nda00860  Porphyrin and chlorophyll metabolism
nda01100  Metabolic pathways
nda01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ndas_2828
Enzymes [BR:nda01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Ndas_2828
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     Ndas_2828
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox HI0933_like Pyr_redox_2 AlaDh_PNT_C FAD_binding_2 NAD_binding_9 Thi4 FAD_oxidored FAD_binding_3 Lycopene_cycl Trp_halogenase TrkA_N NAD_binding_7 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ADH68240
UniProt: D7AZW9
Position
1:complement(3375476..3376942)
Genome map
AA seq 488 aa AA seqDB search
MPEAPHVVVVGGGVSGLTAAHRLRGLGAAVTVVEASDAPGGKLRASPVAGVSVDAGAEAV
LARRPEALDLFSELGLDDRVVHPGPGAAAVYSRGRVRPLPKGQLMGVPGDLRALARSGVL
SGAGTLRAGLDLVLPRTPVRGDVSVADYVGARMGPEVVDRLVEPLLGGVYAGRADRLSLE
STLPQIAPMARRNRSLMHAVRTSLRGRGAAPTKPGPVFASLRGGVAGLVGALAERHADSL
RVGSPVRALERLPEGWRVRLDSGERIACDGVLLACPAPEAARLLAGHAPGASRDLGGVEY
ASMALVTLALPASAFPEPLTGTGFLVPAGEGLTVKAATFSSNKWPWIAEELAAANPGDDL
VVLRCSIGRFGEERVLERSDEELAAAAVRDLATVTGMAGAPVQTRVTRWTDGLPQYAVGH
ASLVERVRADVARSPGLGVCGAVYGGVGVPACVANALQQADLLAGALTTNSPTGGDEAAG
TNQQGVNP
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaagcaccgcacgtcgtcgtggtcgggggcggggtctccggactcaccgccgcg
caccgcctccgtggtctgggcgccgccgtcaccgtggtggaggcctccgacgcccccggg
ggcaagctgcgcgcctcaccggtggcgggggtgtccgtggacgcgggcgccgaggcggtg
ctcgcccgccgccccgaggcgctggacctgttctccgagctgggcctggacgaccgggtg
gtgcaccccggccccggcgccgccgccgtctacagccgcggacgggtgcgccccctgccc
aagggccagctcatgggcgtgcccggcgacctgcgcgcgctcgcccgcagcggggtgctc
tccggggccggaaccctgcgggccggactcgacctcgtgctcccgcgcacgccggtgcgc
ggcgacgtgtccgtcgccgactacgtcggggcccgcatgggcccggaggtcgtcgaccgc
ctcgtcgagcccctcctgggcggcgtgtacgcgggccgcgccgaccggctctccctggag
tccacgctgccgcagatcgcgcccatggcccgccggaaccgctccctgatgcacgccgtt
cgcaccagcctgcgcggcaggggagcggcgcccaccaagcccgggccggtgttcgcctcc
ctgcgcggaggtgtggccggactcgtcggcgcgctcgccgaacgccacgccgacagcctg
cgcgtgggctcgccggtgcgcgccctggaacggctgcccgagggctggcgggtgcgcctg
gacagcggcgaacgcatcgcctgcgacggcgtcctgctcgcttgccccgcccccgaggcg
gcccgcctgctcgccgggcacgcccccggcgcctcccgcgacctcggcggcgtcgagtac
gccagcatggccctggtgaccctggccctgcccgcgtccgccttccccgagccgctcacc
ggcacgggcttcctcgtcccggcgggggaggggctgaccgtcaaggccgccaccttctcc
agcaacaagtggccctggatcgccgaggagctggccgcggccaaccccggcgacgacctg
gtcgtgctgcgctgctccatcgggcgcttcggcgaggagcgggtcctggagcgctccgac
gaggagttggccgcggccgccgtgcgcgacctggccacggtcaccggcatggccggggcg
ccggtgcagacccgggtcacccggtggaccgacggtctgccccagtacgccgtcggccac
gcctccctcgtcgagcgcgtgcgcgccgacgtcgcccgcagtcccggcctgggggtgtgc
ggcgcggtctacggcggtgtgggcgtccccgcctgcgtcgccaacgccctccagcaggca
gacctcctggcgggcgccctcacgacgaacagtcccaccggcggcgacgaggccgccgga
acgaaccagcaaggagtcaacccgtga

DBGET integrated database retrieval system