KEGG   Nocardiopsis dassonvillei: Ndas_3057Help
Entry
Ndas_3057         CDS       T01248                                 

Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
nda  Nocardiopsis dassonvillei
Pathway
nda00220  Arginine biosynthesis
nda01100  Metabolic pathways
nda01110  Biosynthesis of secondary metabolites
nda01130  Biosynthesis of antibiotics
nda01230  Biosynthesis of amino acids
Module
nda_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:nda00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    Ndas_3057
Enzymes [BR:nda01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     Ndas_3057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: ADH68467
UniProt: D7B1P1
Position
1:complement(3652905..3653852)
Genome map
AA seq 315 aa AA seqDB search
MTRHFLRDDDLTPDEQARVLDLADDMKKDRFGHRPLAGPRTVALLFDKPSTRTRLSFAVG
VADLGGSALVLDTASTQMGRGEPLEDTARVLERQVAAVVWRTFAQSDLETLAAHISVPVV
NSLTDEFHPCQILADLQTVREHKGDLAGLTLAYLGDGANNMAHSYLLGGATAGLHVRVGA
PEGHQPDPAVVARAAEIAATTGGSVTVTADAREAARGADVLATDTWVSMGQEDEAADREA
PFRPYAIDADLLATAHPEAIVLHCLPAYRGKEVSAEVIDGPQSVVWDEAENRRHAQKALL
AFLLEASDNPGAVRP
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
gtgacccgccacttcctgcgcgacgacgacctgaccccggacgaacaggcccgggtcctc
gacctcgccgacgacatgaagaaggaccgcttcggccaccggccgctcgccggtccgcgc
accgtcgccctgctcttcgacaagccctccacccgaacccggctgtccttcgccgtgggc
gtggccgacctgggcggcagcgccctggtcctggacaccgcgagcacccagatgggccgc
ggcgagcccctggaggacaccgcccgcgtcctggaacgccaggtcgccgccgtcgtgtgg
cgcaccttcgcccagagcgacctggagaccctggccgcccacatctccgtcccggtggtc
aactccctcaccgacgagttccacccctgccagatcctggccgacctgcagaccgtccgc
gagcacaagggcgacctggccgggctcaccctcgcctacctgggcgacggcgccaacaac
atggcccactcctacctgctcggcggcgccaccgccggactccacgtgcgcgtcggcgcg
cccgaggggcaccagcccgaccccgcggtggtcgcgcgcgccgccgagatcgccgccacc
accggcgggtcggtcacggtcaccgccgacgcccgcgaggccgcccggggggccgacgtc
ctggccaccgacacctgggtgtccatgggccaggaggacgaggccgccgaccgcgaggcg
cccttccgcccctacgcgatcgacgccgacctgctcgccaccgcccaccccgaggcgatc
gtcctgcactgcctgcccgcctaccgcggcaaggaggtctccgccgaggtcatcgacggg
ccgcagagcgtggtctgggacgaggccgagaaccgccgccacgcccagaaggccctgctc
gccttcctgctggaggccagcgacaaccccggggccgtccgcccatga

DBGET integrated database retrieval system