KEGG   Nocardiopsis dassonvillei: Ndas_3121Help
Entry
Ndas_3121         CDS       T01248                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
nda  Nocardiopsis dassonvillei
Pathway
nda00010  Glycolysis / Gluconeogenesis
nda00030  Pentose phosphate pathway
nda00051  Fructose and mannose metabolism
nda00052  Galactose metabolism
nda00680  Methane metabolism
nda01100  Metabolic pathways
nda01110  Biosynthesis of secondary metabolites
nda01120  Microbial metabolism in diverse environments
nda01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ndas_3121
   00030 Pentose phosphate pathway
    Ndas_3121
   00051 Fructose and mannose metabolism
    Ndas_3121
   00052 Galactose metabolism
    Ndas_3121
  Energy metabolism
   00680 Methane metabolism
    Ndas_3121
Enzymes [BR:nda01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Ndas_3121
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Ndas_3121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ADH68530
UniProt: D7B273
Position
1:3736168..3737193
Genome map
AA seq 341 aa AA seqDB search
MRVGVLTGGGDCPGLNAVIRAVVRKGIKDYGYEFIGFRDGWRGPLEGDTMPLDVTAVRGI
LPRGGTILGSSRTNLMKIEGGVERVKDNMAGLGVDALVAIGGEDTLGVARQLHDRGVNVV
GVPKTIDNDLNATDYTFGFDTAVNIAMEAIDRLHTTAESHHRALVVEVMGRHAGWIALHS
GMAAGANVILIPERPFDIDEVVKHVESRFETQYAPIIVVAEGAHPKEGQMELATGETDSF
GHVRLGGIGQRLADEIEQRTGKEARSVVLGHVQRGGTPTAFDRVLATRLGVNAIEAVHDK
AFGKMVGLQGTDIVRVNLAEATDTLKTVPSSRYEEAEVFFG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcgagtcggggtgctgaccggcggtggggactgccctggtctgaacgcggtcatccgc
gcagtggtccgcaagggcatcaaggactacggctacgagttcatcggcttccgggacggc
tggcgcggcccgctggagggcgacaccatgccgctggacgtgaccgccgtgcgcggcatc
ctgccccggggcggcacgatcctgggctcctcgcgcaccaacctcatgaagatcgagggc
ggtgtcgaacgggtcaaggacaacatggccgggctgggcgtcgacgccctggtcgccatc
ggcggcgaggacaccctcggcgtggcccgccagctgcacgaccgcggcgtcaacgtcgtc
ggcgtgcccaagaccatcgacaacgacctcaacgcgaccgactacaccttcggtttcgac
acggccgtgaacatcgcgatggaggcgatcgaccgcctgcacaccaccgccgagtcgcac
caccgcgcgctggtggtggaggtcatgggccgccacgccggatggatcgcgctgcactcg
ggcatggccgcgggcgccaacgtcatcctcatccccgagcggcccttcgacatcgacgag
gtcgtcaagcacgtcgagagccgcttcgagacccagtacgcgccgatcatcgtggtcgcc
gagggcgcgcaccccaaggagggccagatggagctggccaccggggagaccgactccttc
ggccacgtgcgcctgggcggcatcggccagcggctggccgacgagatcgagcagcgcacc
ggcaaggaggcccgctcggtggtcctgggccacgtgcagcgcggcggcacgccgaccgcg
ttcgaccgcgtgctggccacccgtctgggcgtgaacgccatcgaggccgtgcacgacaag
gccttcggcaagatggtcggcctccagggcacggacatcgtccgcgtgaacctggccgag
gccaccgacaccctcaagacggtgccctcctcgcgctacgaggaggccgaggtcttcttc
ggctag

DBGET integrated database retrieval system