KEGG   Nocardiopsis dassonvillei: Ndas_3647Help
Entry
Ndas_3647         CDS       T01248                                 

Definition
(GenBank) Threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
nda  Nocardiopsis dassonvillei
Pathway
nda00260  Glycine, serine and threonine metabolism
nda01100  Metabolic pathways
nda01110  Biosynthesis of secondary metabolites
nda01120  Microbial metabolism in diverse environments
nda01130  Biosynthesis of antibiotics
nda01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nda00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ndas_3647
Enzymes [BR:nda01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Ndas_3647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: ADH69046
UniProt: D7B525
Position
1:4375669..4376673
Genome map
AA seq 334 aa AA seqDB search
MIDLRSDTVTRPTPAMRRAMAEAEVGDDVWGEDPTVRELEEETAGLLGREAALYVPSGHM
ANQLGLYVSTRSGEEVWAHENHHLIGDEQGATAVLARALPRLYSDGLCPTDAVLESWIAG
RGDVHRAEPALVWLENTFTGRVVPLAEQRRVTGFAHRHGLRAHLDGARLWNAAAALDAAP
AEVADGFDTVSVCFSKGLGAPVGSALVGDADTVRRARRGRKLLGAGMRQAGIIAAGALYA
LRHHRERVAEDHERAAELARLISERSGLAVRAQTNMVLVPTPAGQGARYAEAFARHGVAG
LGIGDAVRLVVHLETTGRDVEEAARGVAEAAAEL
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacctgcgttccgacaccgtcacccgccccaccccggccatgcgcagggccatg
gccgaggccgaggtgggcgacgacgtgtggggcgaggacccgaccgtgcgggaactggag
gaggagaccgccgggctgctgggccgggaggccgcgctgtacgtgccgtccgggcacatg
gccaaccagctggggctgtacgtgtccacccgcagcggcgaggaggtgtgggcgcacgag
aaccaccacctcatcggcgacgagcagggcgcgaccgcggtgctggcccgggctctgccg
cgcctgtactcggacgggctctgccccaccgacgcggtgctggagtcgtggatcgccggc
cggggcgacgtccaccgggccgagcccgccctggtgtggctggagaacaccttcaccggc
cgcgtcgtaccgctggccgaacagcgccgggtcaccgggttcgcgcaccggcacgggctg
cgcgcgcacctggacggggctcggctgtggaacgcggccgccgccctggacgccgctccc
gccgaggtcgcggacgggttcgacacggtgtcggtgtgcttctccaagggcctgggcgcc
ccggtgggctcggcgctggtcggggacgccgacacggtgcgcagggcccggcgcgggcgc
aagctgctgggcgcggggatgcgccaggccgggatcatcgccgccggggccctgtacgcg
ctgcgccaccaccgcgagcgggtggccgaggaccacgagcgcgccgcggagctggcccgg
ctgatctccgagcggtccgggctggccgtgcgggcgcagaccaacatggtgctggtgccc
accccggccggacagggcgcgcgctacgccgaggccttcgcccgccacggggtcgcgggg
ctgggcatcggcgacgccgtgcgcctggtggtgcacctggagaccaccggccgcgacgtc
gaggaggccgcccggggcgtggccgaggccgccgccgagctgtga

DBGET integrated database retrieval system