KEGG   Nocardiopsis dassonvillei: Ndas_4205Help
Entry
Ndas_4205         CDS       T01248                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
nda  Nocardiopsis dassonvillei
Pathway
nda00260  Glycine, serine and threonine metabolism
nda00750  Vitamin B6 metabolism
nda01100  Metabolic pathways
nda01110  Biosynthesis of secondary metabolites
nda01120  Microbial metabolism in diverse environments
nda01230  Biosynthesis of amino acids
Module
nda_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ndas_4205
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Ndas_4205
Enzymes [BR:nda01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Ndas_4205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADH69597
UniProt: D7AV47
Position
1:complement(5021142..5022401)
Genome map
AA seq 419 aa AA seqDB search
MAIAATEPTAARSFGPGTALSCRECGERYELTPRFACEFCFGPLEVAYDFGTVTRADIES
GPKSIWRYRSLLPVPANVAELPNMAPGLTPLVRADRLAAELGLDSLHVKDDSGNPTHSFK
DRVVAIAVEAARTFGFTTLSCSSTGNLAGAVGAAAARAGFESCVFIPAGLEEAKVVMASV
YGGKVVAIDGNYDDVNRFCSELIGDPVGEGWGFVNVNLRPYYGEGSKTLAYEIAEQLGWR
LPEQIVVPIASGSQLTKIDKGFQELVKLGLVEDRPYRIFGAQATGCSPVAQAWDKGIDVI
QPVKPDTIAKSLAIGNPADGPYVLDIAKRTGGSVEHVGDDEIVDSIKLLARTEGIFAETA
GGVTTGVLRKLVREGRLDPKAETVVLNTGDGLKTLNAVDAGVSATIKPSLSAFTDAGLA
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggcgattgccgccaccgaacccaccgccgcccgctccttcggccccggcaccgcgctc
tcctgtcgcgagtgcggcgagcgctacgaactcaccccccggttcgcctgcgagttctgc
ttcggcccccttgaggtcgcctacgacttcgggaccgtcacccgcgccgacatcgagagc
ggccccaagagcatctggcgctaccgctccctcctgcccgtcccggccaacgtcgccgag
ctgcccaacatggcccccggcctgaccccgctggtgcgggccgaccgcctcgcggccgag
ctgggcctggactccctccacgtcaaggacgactccggcaaccccacgcactccttcaag
gaccgcgtggtcgccatcgccgtcgaggccgcccgcaccttcgggttcaccaccctgtcc
tgctcctccaccggcaacctggccggagccgtcggcgccgccgccgcgcgcgccgggttc
gagtcctgcgtgttcatccccgccgggctggaggaggccaaggtcgtcatggcctccgtc
tacggcggcaaggtcgtggccatcgacggcaactacgacgacgtcaaccgcttctgctcc
gagctcatcggcgacccggtgggcgagggctggggcttcgtcaacgtcaacctgcgcccc
tactacggcgagggctccaagacgctggcctacgagatcgccgagcagctcggctggcgc
ctgcccgagcagatcgtcgtcccgatcgcgtccggctcccagctcaccaagatcgacaag
ggcttccaggaactggtcaagctcggcctggtcgaggaccgcccgtaccggatcttcggc
gcccaggccacgggctgctccccggtcgcgcaggcctgggacaagggcatcgacgtcatc
cagccggtcaagcccgacaccatcgccaagtcgctggccatcggcaacccggccgacggg
ccctacgtgctggacatcgccaagcgcacgggcggatcggtggagcacgtgggcgacgac
gagatcgtcgactccatcaagctcctcgcccgcaccgagggcatcttcgccgagaccgcg
ggcggcgtcaccaccggcgtgctgcgcaagctcgtccgcgagggcaggctcgacccgaag
gccgagacggtcgtgctcaacaccggtgacgggctcaagaccctgaacgccgtcgacgcc
ggggtgagcgccacgatcaagccgtcgctgagcgccttcaccgacgccggtctggcctag

DBGET integrated database retrieval system