KEGG   Nocardiopsis dassonvillei: Ndas_5129Help
Entry
Ndas_5129         CDS       T01248                                 

Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
nda  Nocardiopsis dassonvillei
Pathway
nda03010  Ribosome
Brite
KEGG Orthology (KO) [BR:nda00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Ndas_5129
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:nda03011]
    Ndas_5129
Ribosome [BR:nda03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Ndas_5129
  Bacteria
    Ndas_5129
  Archaea
    Ndas_5129
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ADH70509
UniProt: D7B8K1
Position
2:280547..280915
Genome map
AA seq 122 aa AA seqDB search
MGTRAQARFVRVTPRKARRVVDLIRGLPADEAQAVLRFAPQSASEPVGKVLASAIANAEH
NDKLDRGTLVVERAWVDEGPTLKRIRPRGFGRAFRVTKRTSHITVVVAERSGASSKTKER
TR
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgggaacgagggcacaggcacggttcgtccgtgttacgccccgaaaggcccgccgggtg
gtggaccttattcgcgggttgcccgctgacgaggcacaggcggtgctccggttcgcgccc
cagtcggcgagcgagcctgttggcaaggtgctggctagcgccatcgccaacgccgagcac
aacgacaagctggaccgcgggacgctggtggtcgaacgcgcgtgggtggacgagggtccg
accctgaagcgcattcgtccgcgaggcttcggccgcgccttccgggtgaccaagcgcacg
agccacatcaccgtggtcgtcgctgagcgctcgggcgcctcgtccaagacgaaggaaagg
acccgatag

DBGET integrated database retrieval system