KEGG   Nocardiopsis dassonvillei: Ndas_5419Help
Entry
Ndas_5419         CDS       T01248                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nda  Nocardiopsis dassonvillei
Pathway
nda00010  Glycolysis / Gluconeogenesis
nda00020  Citrate cycle (TCA cycle)
nda00620  Pyruvate metabolism
nda01100  Metabolic pathways
nda01110  Biosynthesis of secondary metabolites
nda01120  Microbial metabolism in diverse environments
nda01130  Biosynthesis of antibiotics
nda01200  Carbon metabolism
Module
nda_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ndas_5419
   00020 Citrate cycle (TCA cycle)
    Ndas_5419
   00620 Pyruvate metabolism
    Ndas_5419
Enzymes [BR:nda01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Ndas_5419
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_D23 HlyD_3 RnfC_N
Motif
Other DBs
NCBI-ProteinID: ADH70798
UniProt: D7B9E0
Position
2:599101..600504
Genome map
AA seq 467 aa AA seqDB search
MAISKNEPAVGGVQSFKLPDVGEGLVEAELLSWYVKPGDEVGVNQMICEIETAKAVVELP
SPFAGTVRELLAEEGQTVEVGAVIITVDDGSGGSAPEAAPSADSEEREKPLVGYGEKAAS
TQRRPRRRPGPSAPVSPPVPRVSEPAPANTPAVRETRAAPAPAPARAPGRPLAKPPVRKL
AKDLGVDLASVTPTGDNGVVTREDVRAAVGQAPGGPAAAETVQAAPAAAVDRTARERRVP
VKGVRKHTAAAMVGSAFTAPHVTEFLQVDVTRTMKAVARLRERPDFADVRVSPLLLVAKA
LLMAVRRHPEVNASWDEENQEIVVKDYVNLGIAAATERGLVVPNIKDADAMTLPELAAGL
KRLTETARAGKTSPADMSGGTITITNVGVFGVDAGTPILNPGEAAILAFGQIRDMPWVHK
GKLKVRKVTTLSLSFDHRLVDGELGSKVLRDIGTALEDPELTALAWG
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggcgatttccaagaacgaacccgccgtcggcggagtgcagtcgttcaagctgcccgac
gtcggggagggcctggtcgaggccgaactcctctcctggtacgtcaagccgggtgacgag
gtcggggtcaaccagatgatctgcgagatcgagaccgccaaggcggtcgtcgagctcccc
agcccgttcgcggggacggtgcgcgagctgttggccgaggagggccagaccgtggaggtc
ggcgcggtgatcatcaccgtggacgacggctccggcggttccgccccggaggccgccccg
tcggcggactccgaggagcgggagaagccgctggtcggctacggcgagaaggcggcctcc
acccagcgccgaccgcgccgccgcccgggcccctcggcgccggtgtcgccgcccgtgccg
cgcgtcagcgagcccgcgcccgccaacacgcccgcggtgcgggagacgcgggcggccccg
gcccccgccccggcgcgggcgccgggccgtccgctcgccaagccgccggtgcgcaagctg
gccaaggacctcggcgtggacctggcgtcggtcacccccacgggggacaacggcgtcgtc
acccgcgaggacgtgcgggccgcggtcggtcaggctccggggggcccggcggccgcggag
accgtgcaggccgcccccgcggcggccgtggaccgcaccgcgcgcgagcggcgcgtgccc
gtcaagggcgtgcgcaagcacacggccgcggcgatggtcggcagcgcgttcaccgctccg
cacgtcaccgagttcctccaggtggacgtcaccaggacgatgaaggcggtcgcgcgcctg
cgcgagcggcccgacttcgccgacgtgcgggtgtccccgctgctgctggtcgccaaggcc
ctgctcatggcggtccggcggcacccggaggtcaacgcctcctgggacgaggagaaccag
gagatcgtggtcaaggactacgtgaacctggggatcgcggcggccaccgagcgcggtctg
gtggtgcccaacatcaaggacgccgacgccatgaccctgccggagctggcggcggggctg
aagcggctgaccgagaccgcccgggcgggcaagaccagcccggcggacatgtccggcggc
accatcacgatcaccaacgtcggcgtgttcggcgtggacgcgggcaccccgatcctcaac
ccgggtgaggcggccatcctcgccttcgggcagatccgggacatgccctgggtgcacaag
ggcaagctcaaggtccgcaaggtgacgaccctgtcgctgtccttcgaccaccgcctggtc
gacggggagctgggctccaaggtgctgcgcgacatcggcacggcgctggaggacccggag
ctgaccgccctggcctggggctag

DBGET integrated database retrieval system