KEGG   Nitrospira defluvii: NIDE0759Help
Entry
NIDE0759          CDS       T01281                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoylalanine-D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
nde  Nitrospira defluvii
Pathway
nde00471  D-Glutamine and D-glutamate metabolism
nde00550  Peptidoglycan biosynthesis
nde01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nde00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    NIDE0759 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NIDE0759 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nde01011]
    NIDE0759 (murD)
Enzymes [BR:nde01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     NIDE0759 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:nde01011]
 Precursor biosynthesis
  Amino acid ligase
   NIDE0759 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C Pyr_redox_3 2-Hacid_dh_C AlaDh_PNT_C Shikimate_DH NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: CBK40526
UniProt: D8PBB7
Position
724445..725833
Genome map
AA seq 462 aa AA seqDB search
MNVKDLQVTVVGLARSGVGAARLLNHLGARVTLADRKEAQELTAILSQVDRSSIAVKVGA
QYESALEGADLVVISPGVPTHLDALNRVRARGVRVIGELELASRFLTAPVVAVTGTNGKS
TTVTLIGKFLQESGKRAFVGGNLGIAASEAALTSVQAKAGSAAPYEYVVLEVSSFQLETT
EQFHPWIAAILNVTLDHMDRYASVEDYVAAKATIFANQTAGDYSLFNLDDARVAALRGRT
KGTVLGFSRSGATVSGVAGATVLDGDLIVTTVRGRREEICRRSDMRLIGLHNVENVMAAV
TYGLLCGCSIEAVRAVLRSFPGLEHALEVVRERRGVRFVNDSKGTNVDAVLKALEGIDQP
IWLIAGGRDKGGDFSRLERAIRERVKGLILIGEAAGRIQAAMGDFDRCRPAATLRDAVEL
AAREAQPGEVVLLSPACASFDMFADYQDRGRQFKALVQGLPA
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgtgaaagatctccaagtcacggttgtcggactagcccgaagcggagtgggcgcg
gcacgcctgttgaaccatctgggagcccgggtcaccctggccgaccggaaggaggcgcag
gaactgaccgccatcctgtcgcaggtggaccggtcgagcatcgccgtgaaggtgggggcg
cagtacgagtccgcgcttgaaggggccgatcttgtcgtgatcagcccgggtgtgccgact
catctcgatgcgctcaatcgtgtgcgggctcgcggggttcgggttatcggggaactggag
ctggcctcccgctttctgacggcgccggtggtggccgtgaccgggaccaacgggaagagc
acgacggtgacgctgatcggcaagtttctacaggagagcgggaaacgcgccttcgtcggg
ggcaatctcgggatagcggccagcgaggcggcattgacctctgttcaggcgaaggcgggg
agcgccgctccctatgagtatgtcgtgctggaagtctccagtttccagctcgagacgacc
gagcagttccacccctggatcgctgcgattttgaacgtgaccttggaccacatggatcgt
tacgcctcggtggaggactatgtggcggcgaaggcgactatcttcgccaaccaaacggcc
ggcgactattccctgttcaatctcgatgatgcgcgcgtggccgcgcttcgcgggcgcacc
aagggcaccgtcctgggcttcagccgcagcggcgccacggtgtcgggggtggcgggggct
acggtgcttgacggcgacctgatcgtgacgacggttcgcgggcggcgggaggaaatctgt
cgccggagcgacatgcggctgatcgggctgcataacgtcgaaaatgtgatggcggcggtg
acgtatggtctgctctgtggctgttcaatcgaggccgttcgcgccgtgctgcgatctttc
ccagggctggaacatgccctggaggtggtgcgcgagcgtcgcggcgttcgcttcgtgaac
gactccaaaggcaccaacgtggatgcggtgctgaaggcgttggaaggaatcgaccagccc
atctggctgatcgccggcggccgcgacaagggcggcgacttttcccgcctcgaaagggcg
atacgggaacgggtgaaagggctgattctgatcggggaggccgccggccgcattcaggcg
gcgatgggtgattttgaccggtgtcgtcctgcagcgaccctccgcgacgccgtggagctt
gctgctcgcgaggcgcagcccggcgaggtggtcttactctcgccggcctgtgccagtttc
gacatgtttgcggattatcaagaccggggacggcagtttaaggccctggtgcaagggctg
ccggcgtaa

DBGET integrated database retrieval system