KEGG   Nitrospira defluvii: NIDE1978Help
Entry
NIDE1978          CDS       T01281                                 

Definition
(GenBank) conserved protein of unknown function, COG3517
  KO
K11900  type VI secretion system protein ImpC
Organism
nde  Nitrospira defluvii
Brite
KEGG Orthology (KO) [BR:nde00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:nde02044]
    NIDE1978
Secretion system [BR:nde02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   NIDE1978
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VipB TssC CIDR1_gamma
Motif
Other DBs
NCBI-ProteinID: CBK41702
UniProt: D8PEP3
Position
1889990..1891483
Genome map
AA seq 497 aa AA seqDB search
MAEEAKQAQPQGAAVAGTEESGVLDQIINETRIGKDDWERDQSRRQISTLVEEVMKGTLR
VSKDLEATINARIADIDKVLSAQLNAIMHAPEFQKLEGAWRGLHYLVMQSETSTMLKIRV
LNISKDELRKDLEKAVEFDQSALFKKVYEEEYGTFGGAPYGALIGDYEFGRHPQDLALLE
KVSNVAAAAHAPFISAAAPGLLGLEDFTDLPNPRDLAKKFETPDYAKWKSFRESEDSRYV
GLTLPHVLMRLPYGPDTVPVENFNFKEDVDGTDHSKYLWGNAAYAMGARLTDAFAKYGWT
AAIRGVEGGGRVDGLPTHTFRTDEGEIALKCPTEIAITDRREKELSDLGFIPLVHCKGTD
FAAFFGAQSCQKAKKYDTDAANANARLSTQLQYLLAMSRFAHYLKSIMRDKIGSFMTRKD
CEDFLNRWISKYVVSTEDAGQEIKAKFPLKEARVEVAEVAGKPGVYRAIAFLKPHFQLDE
LTVSLRLVAELPPPAKR
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagaggcgaaacaagcgcagcctcagggggcggcggtcgcgggaaccgaggag
agcggggttcttgatcagattatcaatgaaacacgcatcggaaaagacgactgggagcgt
gaccagtcgcgccggcagatttccacccttgttgaggaggtgatgaaaggcaccctccga
gtgtcgaaagacctcgaggcgacgatcaatgcacgcatcgcggacatcgacaaggtttta
tccgcccagctcaacgcgatcatgcatgcaccggagtttcaaaagctggaaggggcctgg
cgcgggctgcactatctcgtcatgcaaagcgaaaccagcaccatgctgaaaattcgtgtg
ctgaatatcagcaaggacgaactacggaaggatcttgagaaggccgtcgaattcgaccaa
agcgcactcttcaagaaagtgtatgaggaagagtacgggaccttcggtggagcgccctat
ggcgccttgattggagattatgagttcggacggcatcctcaggatttggcattgctggag
aaggtctcgaatgtggcagctgcggcacatgcgccgttcatctcagcggctgccccgggc
ctgctggggcttgaagattttacagatcttccgaatcctcgtgatctggccaagaagttc
gaaacgccggattacgccaaatggaagtcgtttcgtgaatcagaggactctcgctatgtg
gggctcaccttgccccatgtgttgatgcggctgccgtacgggccggatacggtgccggtc
gagaactttaatttcaaagaagacgtcgatggcacggaccacagcaagtatctctggggg
aatgccgcctatgcgatgggggctcgtctcacggatgcctttgcaaagtatggctggacc
gcggccattcgtggcgtggaggggggaggacgtgtggatgggttgccgacccatacgttc
cgtaccgatgaaggtgagattgcgctgaagtgtccgaccgagattgccatcaccgaccgg
cgtgagaaggagctgtcggatctcggatttattccgctcgtccattgcaaggggacagac
tttgccgccttcttcggggcccaatcctgccagaaagccaagaaatatgacacggacgcc
gccaacgctaatgcgcggctctcaactcagctccaatatctcctggcgatgtcacgcttc
gcgcattatctcaagtcgatcatgcgggacaaaatcggaagcttcatgacacgcaaagat
tgtgaggatttcctgaatcgctggatcagcaagtatgtcgtaagcacggaagatgccggg
caggagatcaaagccaagtttcccttgaaggaggcccgagtggaggtggcagaggtggca
ggaaagcccggtgtctatagagccattgctttcttgaagcctcacttccagttggatgag
ctgacagtgtcgctcaggttagtggctgagctgccgccgccggccaagcggtag

DBGET integrated database retrieval system