KEGG   Nitrospira defluvii: NIDE2047Help
Entry
NIDE2047          CDS       T01281                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
nde  Nitrospira defluvii
Pathway
nde00260  Glycine, serine and threonine metabolism
nde00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nde01100  Metabolic pathways
nde01110  Biosynthesis of secondary metabolites
nde01130  Biosynthesis of antibiotics
nde01230  Biosynthesis of amino acids
Module
nde_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nde00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NIDE2047 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NIDE2047 (trpA)
Enzymes [BR:nde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NIDE2047 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB BtpA ThiG BAT HMGL-like
Motif
Other DBs
NCBI-ProteinID: CBK41767
UniProt: D8PEV8
Position
1965547..1966347
Genome map
AA seq 266 aa AA seqDB search
MNRLDQTFGRLNARGEKALITYIMAGDPSLQETEQLVLELERAGADVIELGVPFSDPIAD
GPVIQKAAERGLQSGTSLRRILESVRHLRVSTQIPIVLMAYYNNIHAFGEAEFCRIAADA
GVDGLIVPDMPPDEAGPLRGPAGEAGLHLIFLLAPTSTASRRAYVAKESGGFVYYVSITG
ITGAKLQDVAGVRENVAKIRKHTKTPVAVGFGVATPEDAARVAQVADGVIVGSAIVRRVG
EHGQDGRLVQEVGAFVRSLKEAMQPA
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtttggatcaaacattcggccgattgaacgcacggggagagaaagctctgatc
acctacatcatggcgggagacccgtcgttgcaggagacggagcagctggtgctcgaattg
gagcgggcgggcgccgacgtcatcgaattaggggtgccattctccgatcccatcgccgat
ggaccggtgattcagaaagcagccgaacgtggtctccaaagcggtacatcccttcggagg
attctcgaatcggtgcggcatcttcgggtctcgacccagatccctatcgtcttgatggcc
tattacaacaacattcacgcgttcggtgaggcggaattctgccggatcgctgcggatgcg
ggtgtggatgggttgatcgttccggatatgccgccggatgaggcggggccgttgcgtggt
ccggctggtgaggccgggctccatctgatttttctgttggctccgaccagcactgcgtcg
cggcgggcctatgtggcgaaggagtccggcggatttgtctattatgtttccatcacgggc
attactggggctaaactacaggacgtggcgggcgtacgcgagaacgtcgccaagatcaga
aagcacaccaagaccccggtggcggtgggattcggcgtggcgactccggaggatgccgcg
cgggtggcgcaggtcgccgatggcgtgatcgtgggcagcgcaattgtgcgtcgtgttgga
gagcatgggcaggatggccgactcgttcaggaagtgggtgcgttcgtgcgatccctcaag
gaggcgatgcagccggcctag

DBGET integrated database retrieval system