KEGG   Nitrospira defluvii: NIDE3456
Entry
NIDE3456          CDS       T01281                                 

Definition
(GenBank) putative Type I secretion membrane fusion protein HlyD
  KO
K11003  hemolysin D
Organism
nde  Nitrospira defluvii
Pathway
nde03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:nde00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    NIDE3456
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nde02000]
    NIDE3456
   02044 Secretion system [BR:nde02044]
    NIDE3456
Transporters [BR:nde02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   NIDE3456
Secretion system [BR:nde02044]
 Type I secretion system
  alpha-Hemolysin/cyclolysin transporter
   NIDE3456
SSDB
Motif
Pfam: HlyD_3 HlyD_D23 HlyD Biotin_lipoyl_2 Biotin_lipoyl Acyl-CoA_dh_1 PTAC TmoB DNA_pol3_alpha
Other DBs
NCBI-ProteinID: CBK43142
UniProt: D8PIQ5
Position
complement(3449865..3451256)
AA seq 463 aa
MKRLLRHLAVWRAAWQIEQTMPSAVVSGGSAVEFLPAVLEIQHAPPSPIGRAILWTIMLV
FTTAVTWSSLSHIDIVAVAPGKTIPSGHSKTIQPFETGVIASIHVQDGQTVRQGEVLIEL
DATQNGADRDRALNEYRAALVEAARLRALIAGYSTFEVPEEADPQFILLQQQLLRDQVAE
FSARVDASRHLIGQRRAALDATKDNLRRLEATVPIEAERAKAYRSLLAQQYVSKMDYLQF
EQQRIDKAQEWAGQKSKLRQDQAALAEAEQNYHALLSEFQQSKQAELSTTETKTASLLQE
VRKAGQKIHLQKLVSPIDGVVQQLAVHTVGGVVTPAQPLLIVVPQDHPVEVEAQFENKDI
GFVKEGQPVEIKVETFPFTLYGTIPGKVLSVSGDAVPLDKDKGGLIYAGRISMDRATMQV
EGRHIHLSPGMAVIVEVKTGQRRVIEYLLSPLLKFRRESLRER
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgaagaggttattgcgacatctggcggtgtggcgtgcggcatggcaaattgagcaaacc
atgccctcggcggttgtttccggcgggagtgcggtggagtttcttcctgctgtgcttgaa
attcaacatgcgccgccttcgccgatcggccgtgccattctctggaccatcatgctggtg
ttcacgacggcggtgacctggtcctcgctcagtcacattgatatcgtcgcggtggcgcca
ggcaagactattcccagtggtcattccaaaaccatccagccattcgaaaccggtgtcatt
gcttccattcacgtacaagacggtcaaaccgttcgtcagggagaggtgctgatcgagctg
gatgcgacgcaaaacggcgctgatcgggatcgggcgctcaacgaatatcgagccgcgctg
gtcgaggcggcccgattgcgcgcgttgattgcggggtactccactttcgaggttccggaa
gaagccgatccgcaattcatattgcttcagcaacaactcttgcgggatcaagtcgcggaa
ttttccgcccgggttgatgcatcccggcatctcattggacaacgccgggcggcgttggat
gcgacgaaggataatctccggaggctggaggcaactgttccgatcgaagctgagcgtgcc
aaggcctatcggtccctgttggcgcaacagtatgtgtcgaagatggactatctccaattc
gagcagcaacgcatcgacaaggctcaggagtgggccgggcagaagagcaagttgcggcag
gatcaggctgcgctggctgaggccgagcaaaattaccacgcgctcctctcggagtttcag
cagagcaaacaggccgagctctcgaccaccgaaacgaagacagcctcgctgcttcaagaa
gtgcgcaaggctggacagaaaatccacttgcagaagttggtgtcgccgatcgacggggta
gtgcaacagctggcggtgcatacggtgggtggtgtcgtcacgcccgcccagccattgctc
atcgtcgtgcctcaagaccatcccgtggaagttgaagcacagttcgagaacaaggacatc
ggctttgtaaaggaagggcagccggttgaaatcaaagtcgagacgtttccgttcacctta
tatggcaccattccgggaaaggttttgagtgtctcgggtgatgcggtaccgttggataaa
gacaagggcggcctgatctatgccggtcgtatcagcatggatcgcgcgacgatgcaggtg
gaaggaagacacattcatctctcgcccgggatggccgtcattgttgaagtcaaaaccggc
cagcgtcgggtgattgaatacctgctgagtcccttactgaagtttaggcgggagagtttg
agggagcgttag

DBGET integrated database retrieval system