KEGG   Naumovozyma dairenensis: NDAI_0A05390Help
Entry
NDAI_0A05390      CDS       T02234                                 

Gene name
NDAI0A05390
Definition
(RefSeq) hypothetical protein
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
ndi  Naumovozyma dairenensis
Pathway
ndi00740  Riboflavin metabolism
ndi00790  Folate biosynthesis
ndi01100  Metabolic pathways
ndi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ndi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    NDAI_0A05390 (NDAI0A05390)
   00790 Folate biosynthesis
    NDAI_0A05390 (NDAI0A05390)
Enzymes [BR:ndi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     NDAI_0A05390 (NDAI0A05390)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydro2
Motif
Other DBs
NCBI-GeneID: 11494557
NCBI-ProteinID: XP_003667937
UniProt: G0W4F6
Position
1:complement(1218389..1219399)
Genome map
AA seq 336 aa AA seqDB search
MTKSLPKVECIARARIPTTQGPDIFLHLYTNDQDNKEHLAIVFGEDIRSRSLFRQRPNET
QQDRMIRGAYVGKLHPGRTIADKDDRLGLQLHFDTNGELLPDYNFTTWDSAKNSTLVRIH
SECYTGENAWSARCDCGEQFDRAGKLISLDVEPETGIKGGNGHGVIVYLRQEGRGIGLGE
KLKAYNLQDLGADTVQANLLLKHPVDSRDFSLGKSILIDLGIENVRLLTNNPDKINQIDY
PPILKCVERVPMVPIHWTDANKGIDSKEIEGYLRTKIERMGHLLTEPLTLHSSEQQQHIT
KQEQHSCSTHNTANTETDSTIVTSTTKRDNAKIINA
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgactaaatcattaccaaaagttgaatgtatagcaagagcacgtatccccaccacacaa
ggtccagacatttttctccatttatatacaaatgatcaagataacaaggaacatctagcc
atagtattcggtgaagatataagatctcgttcacttttccgtcaaagacccaacgaaaca
caacaagatcgtatgattagaggtgcttacgtggggaaattacatcctggtagaaccatt
gctgataaagatgatagattaggtttacaattacatttcgatactaatggtgaattatta
cctgattataatttcactacttgggattcagctaaaaattctacattggtaaggattcat
agtgaatgttatactggtgaaaatgcatggagtgcaagatgtgattgtggtgaacaattc
gatagagcgggtaaattgatttcattggatgtggaaccagaaactggtattaaaggtggg
aatggtcatggtgttatagtttatttaagacaagaaggtcgtgggattggactaggtgaa
aaattgaaagcttataatttacaagatttaggggctgatacagtacaagctaatttatta
ttgaaacatcctgttgattcaagagatttttcattggggaaatctatattgattgatttg
ggtattgagaacgttagattgttgactaataatcctgataagattaatcaaattgattat
ccaccaattttgaagtgtgtagaaagagttccaatggtaccaatccattggactgatgct
aataaaggtatcgattctaaagaaattgaaggttatctaaggacaaaaattgaaagaatg
ggtcatcttctaacggaacctttaactttacactctagtgaacaacaacaacatataacg
aaacaagaacaacattcatgctcaacacataataccgctaatactgaaacagattcaact
atagtaacctccacaacaaagagagataacgctaagataataaacgcttaa

DBGET integrated database retrieval system