KEGG   Naumovozyma dairenensis: NDAI_0A07170
Entry
NDAI_0A07170      CDS       T02234                                 

Gene name
NDAI0A07170
Definition
(RefSeq) hypothetical protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
ndi  Naumovozyma dairenensis
Pathway
ndi00100  Steroid biosynthesis
ndi01100  Metabolic pathways
ndi01110  Biosynthesis of secondary metabolites
Module
ndi_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:ndi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    NDAI_0A07170 (NDAI0A07170)
Enzymes [BR:ndi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     NDAI_0A07170 (NDAI0A07170)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 11494220
NCBI-ProteinID: XP_003668114
UniProt: G0W4Y3
Position
1:1633101..1634432
AA seq 443 aa
MTLNPKTTKFEFGGPLGVTVLTIFLPILSVVLNELIRSDYYIKGIFQNFSINETLKNITP
FSSLLQLTFNKQVWTYYLTWFISLLVFDTILPGKYMNGCELRDGTKLTYKINGISMVTLL
ILILSVRWNLTNGTMPELQFLYDHILELCLVTIVFAFILSIYCYAVSFIPLLGSKRNGQD
GKEKVLAVGGNSGNLIYDWFIGRELNPRFFFNIIDIKMFCELRPGMLLWLLINLSCLHHH
YLMNDGEINDALLLVNILQAFYIFDGVLNEEGVLSMMDITTDGFGFMLAFGDLTFVPFTY
SLQARYLSVSPITLGYTRCILISTIMCIGYYIFHSSNMQKSNFRQGKLENLKSIQTKRGT
KLLCDGWWSKSQHINYFGDWLISLSWCLTTWFQTPLTYYYSIYFATLLMHRQIRDEEKCH
AKYGKSWEEYQRKVPYKIIPYVY
NT seq 1332 nt   +upstreamnt  +downstreamnt
atgacattgaatccaaagaccactaaatttgaatttggtgggcctctaggagtcaccgta
ttaactatcttcctaccaatcttatcagtggtattaaatgaacttatacgctcagattat
tacatcaagggtattttccaaaatttttcaatcaatgaaacattgaaaaacatcactccc
ttctcctcattattacaattaactttcaataaacaagtttggacatattacttaacttgg
ttcatctctttgttggtctttgataccatattaccggggaagtacatgaatggttgtgaa
ttaagagatggtacaaaacttacttataagattaatggtataagtatggtcactttatta
attttgatcctttccgttagatggaatttaactaatggtaccatgcctgaattacaattc
ttatatgatcatattttggaattatgtctagttactattgtatttgcattcatcttaagt
atctattgttacgcggttagttttattcctttgttagggagtaaaagaaatggtcaagac
ggcaaggaaaaggtattagccgtgggagggaactcgggcaacttaatttatgattggttt
attgggagagaattaaatccaagatttttctttaacataattgatataaagatgttttgt
gaattaagacctggtatgttattgtggttattgattaacttgtcatgtttacatcatcat
tatttaatgaatgatggagagattaatgacgctttattgttagttaacatattgcaagca
ttttatatctttgatggcgtcttgaatgaagaaggtgttctttcaatgatggatattact
actgatgggtttggattcatgttagccttcggtgatttaacttttgtaccattcacatat
tcattgcaggcaagatatttgagtgtgtcaccaatcactttgggttataccagatgtata
ttaatttcaacaataatgtgtattggttattatattttccattcatcaaatatgcaaaaa
tcaaattttaggcaagggaaattggaaaatctgaaaagtattcaaactaaacgtggtaca
aaactattatgtgacggatggtggtcgaaatctcaacatattaactatttcggtgattgg
ttgatatcattaagttggtgtttaactacttggttccaaactccattgacatattattat
tccatatattttgctacattattaatgcatagacaaataagagatgaagaaaaatgccat
gcaaaatatggtaaaagttgggaagaatatcaaaggaaagttccatacaagatcatccca
tatgtatattga

DBGET integrated database retrieval system