KEGG   Naumovozyma dairenensis: NDAI_0B01240Help
Entry
NDAI_0B01240      CDS       T02234                                 

Gene name
NDAI0B01240
Definition
(RefSeq) hypothetical protein
  KO
K08738  cytochrome c
Organism
ndi  Naumovozyma dairenensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 11498450
NCBI-ProteinID: XP_003668401
UniProt: G0W5U7
Position
2:complement(292907..293245)
Genome map
AA seq 112 aa AA seqDB search
MPAAAEYKPGSEKKGATLFKTRCLQCHTVEEGGPHKVGPNLHGIFGRRSGQAVGYSYTDA
NIKKNVEWNVNNMSEYLTNPKKYIPGTKMAFGGLKKEKDRNDLITYLKKACE
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgccagctgctgcagaatataaacctggatctgaaaagaaaggtgctaccttattcaaa
accagatgtttacaatgtcatacagtagaggaaggtggaccacataaagtgggtccaaat
ctacatgggatctttggccgtcgttcaggtcaagctgtcggctattcatacactgatgct
aatatcaagaagaatgtggaatggaatgtaaataatatgtctgaatatttaactaatcca
aagaagtacattccgggtactaagatggccttcggtgggttaaagaaagaaaaagacaga
aacgatttgatcacatatttgaagaaagcttgcgaataa

DBGET integrated database retrieval system