KEGG   Naumovozyma dairenensis: NDAI_0B01690Help
Entry
NDAI_0B01690      CDS       T02234                                 

Gene name
NDAI0B01690
Definition
(RefSeq) hypothetical protein
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ndi  Naumovozyma dairenensis
Pathway
ndi00040  Pentose and glucuronate interconversions
ndi00052  Galactose metabolism
ndi00500  Starch and sucrose metabolism
ndi00520  Amino sugar and nucleotide sugar metabolism
ndi01100  Metabolic pathways
ndi01130  Biosynthesis of antibiotics
Module
ndi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NDAI_0B01690 (NDAI0B01690)
   00052 Galactose metabolism
    NDAI_0B01690 (NDAI0B01690)
   00500 Starch and sucrose metabolism
    NDAI_0B01690 (NDAI0B01690)
   00520 Amino sugar and nucleotide sugar metabolism
    NDAI_0B01690 (NDAI0B01690)
Enzymes [BR:ndi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     NDAI_0B01690 (NDAI0B01690)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDPGP
Motif
Other DBs
NCBI-GeneID: 11497790
NCBI-ProteinID: XP_003668446
UniProt: G0W5Z2
Position
2:402710..404209
Genome map
AA seq 499 aa AA seqDB search
MSGSKRHTKTQSTYAFESNTSNVAASQMRNALNKLADSVKDEQLRFQFENQLDSFFSLFR
RYLVEKSSGSTLEWEKIKSPNPNEVVDYNVISQQPENVTNLSKLAVLKLNGGLGTSMGCV
GPKSVIEVRDGNTFLDLSVRQIEHLNRQYDSDVPLLLMNSFNTDKDTEHLIKKYSANRIR
IRSFNQSKFPRVYKDSMLPVPTTINDPLDAWYPPGHGDLFESLHASGELDALIAQGREIL
FVSNGDNLGATVDLKILNHMLETGAEYIMELTDKTRADVKGGTLINYDGQVRLLEVAQVP
KEHIDEFKNIRKFKNFNTNNLWINLKAIKRLIESSALQMEIIPNGKTIVRNGHEINVLQL
ETACGAAIRHFEGAHGVVVPRSRFLPVKTCSDLLLVKSDLFYLQHGALKLDPTRFGPNPL
IKLGSHFKKVSNFNSRISHIPKIVELDHLTITGNVFLGKDVTLRGTVIIVCSDGQRIDIP
NGSILENVVITGNLQILEH
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggatctaaaagacacacaaagactcaatctacttatgccttcgaaagcaacaca
agtaatgtcgcagcttctcaaatgagaaatgctctaaacaaattggctgattctgtcaaa
gatgaacaattacgtttccaattcgaaaatcaattagattcattcttctccctattcaga
agatatcttgttgaaaaatcttctggttccactttagaatgggaaaagattaaatctcca
aatccaaatgaagtcgtggattataacgttatcagtcaacaaccagaaaacgttactaat
ttatctaaattggctgtcttaaaattaaatggtggtcttgggacatcaatggggtgcgtg
ggtccaaaatctgtcatcgaagttagagatggtaacactttcttagacctttctgtaaga
caaattgaacatttaaatagacaatacgatagtgacgtccccctattattaatgaattca
tttaatacggataaagatactgaacatttaattaaaaaatattctgctaatagaattaga
attagatcttttaatcaatctaaattcccaagagtatataaggattccatgttaccagtg
ccaactactattaatgacccattagatgcttggtacccacctggtcatggtgatcttttc
gaatcattacatgcttctggtgaattagatgctttaattgctcaaggtagagaaatcctt
ttcgtttcaaatggtgataatttaggtgctactgtggatttgaaaatattaaatcatatg
ttagaaactggtgctgaatatattatggaattgaccgataagacaagagcagatgtgaaa
ggtggtactttaattaattatgatggtcaagttagattattagaagttgcacaagttcca
aaggaacatattgatgaatttaaaaatattagaaaatttaaaaattttaatacaaataat
ttatggattaatttaaaggcaattaaaagattaattgaatcaagtgctttacaaatggaa
atcattccaaatggtaagacaattgtaagaaatggtcatgaaattaatgtattacaatta
gaaactgcttgtggtgctgcaattagacattttgaaggtgctcatggtgtagtggttcca
agatcaagattcttaccagtgaaaacttgttcagatttattattagtaaaatctgattta
ttctatttacaacatggtgctttgaaacttgatccaacaagatttggcccaaatccatta
attaaattaggttctcattttaaaaaagtttccaatttcaattcaagaatttctcatatt
ccaaaaattgttgaattagatcatttaaccattacaggtaacgttttcttaggtaaagat
gtcactttaagaggtacagttatcattgtttgttctgatggacaaagaatcgatatccca
aatggttccatattggaaaatgttgtcatcacaggtaatttacaaatattagaacattga

DBGET integrated database retrieval system