KEGG   Naumovozyma dairenensis: NDAI_0C02860Help
Entry
NDAI_0C02860      CDS       T02234                                 

Gene name
NDAI0C02860
Definition
(RefSeq) hypothetical protein
  KO
K03146  cysteine-dependent adenosine diphosphate thiazole synthase [EC:2.4.2.60]
Organism
ndi  Naumovozyma dairenensis
Pathway
ndi00730  Thiamine metabolism
ndi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ndi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    NDAI_0C02860 (NDAI0C02860)
Enzymes [BR:ndi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.60  cysteine-dependent adenosine diphosphate thiazole synthase
     NDAI_0C02860 (NDAI0C02860)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thi4 DAO Pyr_redox_2 NAD_binding_8 FAD_binding_2 NAD_binding_9 FAD_oxidored Lycopene_cycl HI0933_like Pyr_redox_3 EF_assoc_1 GIDA K_oxygenase Trp_halogenase
Motif
Other DBs
NCBI-GeneID: 11496282
NCBI-ProteinID: XP_003669189
UniProt: G0W835
Position
3:complement(659616..660578)
Genome map
AA seq 320 aa AA seqDB search
MSTTQTSVSQLQLNSVAENPLGELAKIDNWNDFQFAPIREATVSRAMTSRYYQDMDKYAI
SDVVIVGAGSSGLSAAYVIAKNRPDLKIAIIEQNLAPGGGCWVSGQLLSAMVLRKPADLL
LKEIGVEYEDQGDYVVVKHAALFTSTILSKILAFPNVKLYNGTCVEDLVTKPNEHGKLTV
SGVVTNWTLVTLAHDTQSCMDPNVIELAGYSDDGSRDATQKHGVILSTTGHDGPFGAFCA
KRIVQLDDNMKLGGMKGLDMNSAERGVVNHAGKYPGVDNIYFAGMESAELYGINRMGPIF
SSMLISGVKAGLEIVKHFSD
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgtctaccactcaaacttctgtttctcaattacaattgaactctgtcgctgaaaaccca
ttgggtgaattagccaaaattgacaactggaatgatttccaatttgctccaattcgtgaa
gctactgtctctcgtgctatgacttctcgttattatcaagatatggataaatatgccatt
tctgacgtcgtcattgtcggggccggttcttctggtttatctgctgcttatgtcattgct
aaaaacagaccagacttgaaaatagccattatcgaacagaatttggctccaggtggtgga
tgttgggtttccggtcaattattgagtgccatggttttaagaaaaccagctgatctatta
ttgaaggaaattggtgttgagtatgaagaccaaggtgactatgttgtcgtcaagcatgcg
gctctatttacttctaccatcttgtccaagatcctagcctttccaaacgtcaaattatat
aacggtacctgtgttgaagacttagtcaccaagcccaatgagcatggtaaactaacagtc
agcggtgttgtcactaactggactttagtaactttagcccatgacactcaaagttgtatg
gatccaaacgtcatcgaattagctggttacagtgacgatggttcccgtgatgctactcag
aagcatggtgttatcttgtccactactggtcatgatggcccatttggtgctttctgtgcc
aaaagaattgttcaattagatgacaatatgaaattaggtgggatgaaaggtctagatatg
aacagcgccgaaagaggtgtagttaaccacgctggtaagtatccaggtgttgataacatt
tactttgctggtatggaatctgccgaattgtatggtattaaccgtatgggtccgatattt
tccagtatgttgatttctggtgtcaaggctggtttggaaatcgtcaagcatttctctgat
taa

DBGET integrated database retrieval system