KEGG   Naumovozyma dairenensis: NDAI_0C03590Help
Entry
NDAI_0C03590      CDS       T02234                                 

Gene name
NDAI0C03590
Definition
(RefSeq) hypothetical protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ndi  Naumovozyma dairenensis
Pathway
ndi00450  Selenocompound metabolism
ndi00970  Aminoacyl-tRNA biosynthesis
ndi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ndi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    NDAI_0C03590 (NDAI0C03590)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    NDAI_0C03590 (NDAI0C03590)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ndi01007]
    NDAI_0C03590 (NDAI0C03590)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ndi03016]
    NDAI_0C03590 (NDAI0C03590)
Enzymes [BR:ndi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     NDAI_0C03590 (NDAI0C03590)
Amino acid related enzymes [BR:ndi01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   NDAI_0C03590 (NDAI0C03590)
Transfer RNA biogenesis [BR:ndi03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    NDAI_0C03590 (NDAI0C03590)
 Prokaryotic type
   Other AARSs
    NDAI_0C03590 (NDAI0C03590)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g MetRS-N tRNA-synt_1 tRNA-synt_1e Anticodon_1 Sigma54_CBD
Motif
Other DBs
NCBI-GeneID: 11494764
NCBI-ProteinID: XP_003669262
UniProt: G0W8A8
Position
3:complement(823972..826218)
Genome map
AA seq 748 aa AA seqDB search
MPAQISFDKVKDHSHAISFANNLKIALAIEYATKDLKLTINDDSNIAQLVVSDSYQLFNP
NAILRYALNDFTDQESEANQFAVTIVEKALISSETSSKEVVTKTLEQYLPYPIEEPVSAT
KLILLADILALDPTTVKSKFTALPEKILKAIIEAEKATPRSPSMFKNTGAVNVEQNFKVK
QQAQEIVPEKGERNILITSALPYVNNVPHLGNIVGSVLSADIFARYCKTRNYNTLFVCGT
DEYGTATETKALEEGCTPRELCDKYHKIHSDVYKWFQIGFDYFGRTTTEQQTEIAQDIFK
KLDKNGYLEEQSMKQLYCPVHNSYLADRYVEGECPKCHYEDARGDQCDKCGGLLDPFELI
NPRCKLDNATPIPKFSDHIFLSLDKLEPSIAKWVEKSSEEGQWSKNSKTITNSWLKDGLK
PRCITRDLVWGTPVPLEKYKDKVLYVWFDATIGYVSITANYTKKWEQWWKDPENVKLYQF
MGKDNVPFHTVVFPGSQLGTGDEWTMLHHLNTTEYLQYEGGKFSKSRGVGVFGNNAQDSG
VSPSVWRYYLASVRPESSDSHFSWDDFVARNNSELLANLGNFVNRLIKFVNAKYNGVVPK
YDHKQVPNYDGLKKDIDVILKSYVEKMEYGHERSGLELAMSLSARGNLFLQENKLDNSLF
SQFPAKSDAVVGVGLNIIYTVTSLIYPFMPETAEKIYKMLNAPALKIDEEFHLAILEGHN
INKAEYLFHRIDEKQVEQWRNLYGGKQV
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgccagcccaaatttcatttgataaggtaaaagaccattcccatgccatttcttttgct
aataatttaaaaattgcccttgccatcgaatatgcaaccaaggatttgaaattaaccatc
aacgacgattcgaacatcgcccaattagttgtttctgactcttatcaactattcaaccca
aatgctatcttaagatatgctcttaatgattttactgaccaagaatcagaagctaaccaa
tttgctgtaaccattgtagaaaaggcattgatctcttctgaaacttcatccaaagaagtc
gttaccaagactttagaacaatatttaccataccccattgaagagccagtttcagcaacc
aaattaatactactagcagacattcttgctttggatccaacaactgtgaaatcaaaattt
accgctttacctgaaaaaatcttaaaggccattattgaagctgaaaaagctactcctcgt
tctccatctatgttcaaaaatacgggtgccgttaacgttgaacaaaatttcaaagtgaaa
caacaagcacaagaaattgtaccagagaagggtgaaagaaatatcttaatcacctctgca
ttaccatatgttaacaacgttcctcatttaggtaatatcgttggtagtgtcttatcggct
gatatctttgctcgttattgtaaaacgagaaattacaatactttatttgtttgtggtact
gatgaatatggtactgctactgaaactaaagctttggaagaaggttgtactccacgtgaa
ttatgtgataagtaccataaaattcatagtgatgtctacaaatggttccaaattggattc
gattatttcggtagaacaactacagagcaacaaactgaaattgctcaagatatcttcaaa
aaattagataaaaatggttatctagaagaacaatctatgaaacaattgtattgtcctgtc
cataattcctacttggctgatagatacgtcgaaggggaatgtccaaaatgtcattatgaa
gacgcaagaggtgatcaatgtgataagtgtggtggtttgttagatccttttgaattaatt
aaccctcgttgtaaattagataacgctacaccaattccaaaattctcagatcatatcttt
ttatcattagataaattagaaccaagcattgccaaatgggttgaaaaatcttctgaagaa
ggacaatggtcaaagaactctaagaccattaccaattcttggttaaaggatggtttgaaa
cctcgttgtatcacgagagatttagtttggggtacaccagttccattagaaaaatataaa
gataaggttctttacgtttggttcgatgccactattggttacgtatctattactgctaac
tacactaaaaaatgggaacaatggtggaaagatccagaaaatgttaaattataccaattt
atgggtaaagataatgttcctttccatacagtcgttttcccaggttctcaactaggtact
ggtgacgaatggactatgttacatcatttgaatactacagaatacttacaatacgaaggt
ggtaaattctccaagagtagaggcgttggtgtctttggtaataacgctcaagattcaggt
gtttctccaagtgtctggagatattatttggcatctgttagacctgaatcaagtgattct
catttctcatgggatgattttgttgcaagaaacaattctgaactgttggctaacttaggt
aattttgttaacagattaatcaaattcgttaacgctaagtataacggtgttgttccaaaa
tatgatcataagcaagttccaaactacgatggcttgaagaaagatattgatgtgatattg
aagtcttacgttgaaaagatggaatatggtcatgaaagaagtgggttagaattagccatg
tcattaagtgcacgtggtaatttgtttttacaagaaaataaactagataacagtttgttc
tctcaattcccagctaaatcagatgctgttgttggtgtaggtttgaatatcatctatact
gttacttcattgatttacccattcatgccagaaactgccgaaaagatttataagatgttg
aatgctcctgctttaaagattgatgaagaattccatttggctatcttggaaggtcacaat
attaataaagctgaatatttattccaccgtattgatgaaaaacaagttgaacaatggaga
aatttgtacggtggtaaacaagtttaa

DBGET integrated database retrieval system