KEGG   Naumovozyma dairenensis: NDAI_0C03600Help
Entry
NDAI_0C03600      CDS       T02234                                 

Gene name
NDAI0C03600
Definition
(RefSeq) hypothetical protein
  KO
K13179  ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13]
Organism
ndi  Naumovozyma dairenensis
Brite
KEGG Orthology (KO) [BR:ndi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ndi03041]
    NDAI_0C03600 (NDAI0C03600)
   03009 Ribosome biogenesis [BR:ndi03009]
    NDAI_0C03600 (NDAI0C03600)
Enzymes [BR:ndi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     NDAI_0C03600 (NDAI0C03600)
Spliceosome [BR:ndi03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    NDAI_0C03600 (NDAI0C03600)
Ribosome biogenesis [BR:ndi03009]
 Eukaryotic type
  90S particles
   Helicases
    NDAI_0C03600 (NDAI0C03600)
  Pre-60S particles
    NDAI_0C03600 (NDAI0C03600)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DEAD Helicase_C DUF4217 ResIII SecA_DEAD AAA_22 AAA_30
Motif
Other DBs
NCBI-GeneID: 11494765
NCBI-ProteinID: XP_003669263
UniProt: G0W8A9
Position
3:complement(826718..828277)
Genome map
AA seq 519 aa AA seqDB search
MSSPSTKRPRDASDDGETSTSVKTTQNQESTLKLQVEKENSTTSTTTAIPTNFNDLSLSS
QTMKAIEKMGFESLTPVQARTIPPLMAGRDVLGAAKTGSGKTLAFLIPAIELLYSLKFKP
RNGTGIIVITPTRELALQIFGVVRELMEFHSQTFGIVIGGANRRQEAEKLMKGVNILIAT
PGRLLDHLQNTKGFIFKNLKALIIDEADRILEIGFEDEMKQIIRILPNEDRQSMLFSATQ
TTKVEDLARISLRKGPLFINVESEKDTSTADGLEQGYVVCDSDKRFLLLFSFLKRNQKRK
SLSFYSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNADKGILVCTDVAAR
GLDIPAVDWIVQFDPPDDPRDYIHRVGRTARGTKGKGKSLMFLTPNELGFLRYLKAAKVP
LNEYEFPTNKIANVQSQLEKLIKSNYYLHQTAKDGYRSYLQAYASHSLKTVYQIDKLDLA
KVAKSYGFSIPPKVNITIGASGKTDKTNTKRRKTNNQRH
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgtcatctccttccacgaaacgtcccagagatgcctcggatgatggtgaaacttcaacc
agtgtaaagacgactcaaaaccaagaatccacattgaaactacaagtagaaaaggaaaat
tccaccacttctacaacaacagccatcccaaccaacttcaacgacttatccttatcatcc
caaacaatgaaagctatcgaaaagatgggattcgaatcattgactccagttcaagcacgt
accatcccaccattaatggcaggcagagatgttcttggtgcagccaagacaggatcaggt
aagaccttagcgttcttgatccctgccattgaattattatactctttaaaattcaaacca
agaaacggtactgggatcatcgtgatcactccaacgagagaattggctttacaaattttt
ggggtcgtgagagaattgatggaattccattcacaaactttcggtatcgttattgggggt
gctaatagaagacaagaagctgagaaattaatgaagggggttaatattttgatcgctact
ccggggagattattggatcatttacaaaatactaaagggtttatctttaagaatttaaaa
gcattaattattgatgaagctgatagaattttggaaattgggttcgaagatgaaatgaaa
caaattattagaattttacctaatgaagatagacaatctatgttgttttctgctacacaa
actactaaagtggaagatttagctagaatttctttgagaaagggacctcttttcattaat
gttgaatctgaaaaggatacatctactgcagatgggttagaacaagggtatgtggtttgt
gatagtgataaacgtttcctattgttattttcatttttgaaaagaaatcaaaaaagaaaa
tcattgtctttttattcatcttgtaattctgttaaatattacgcagaattattaaattat
atcgatttacctgttttagaattacatgggaaacaaaaacaacaaaaaagaacaaataca
tttttcgaattttgtaacgctgataaaggtatattagtgtgtacggacgttgctgcaaga
ggtttagatatccctgctgttgattggatcgtccaattcgatcctcctgatgatccaaga
gattatatccatagagttggtagaaccgcaagaggtactaagggtaagggtaaatcttta
atgttcttgactccaaatgaattaggtttcctaaggtatttgaaagccgctaaagtgcca
ttaaatgaatatgaattcccaacaaataaaatcgctaatgttcaatcacaattagaaaaa
ttgattaaatcaaattattatctacatcaaacagccaaagacggttatagatcttattta
caagcttatgcatcacattctttgaaaactgtgtatcaaatcgataagttggatttggcc
aaagtggcaaaatcttacgggttctcaatacctccaaaggttaatattaccatcggtgca
agtgggaaaactgataagacaaatacgaaaaggcgtaaaaccaacaaccaaaggcattaa

DBGET integrated database retrieval system