KEGG   Naumovozyma dairenensis: NDAI_0C03630Help
Entry
NDAI_0C03630      CDS       T02234                                 

Gene name
NDAI0C03630
Definition
(RefSeq) hypothetical protein
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
ndi  Naumovozyma dairenensis
Pathway
ndi00970  Aminoacyl-tRNA biosynthesis
ndi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ndi00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    NDAI_0C03630 (NDAI0C03630)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ndi03029]
    NDAI_0C03630 (NDAI0C03630)
Enzymes [BR:ndi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     NDAI_0C03630 (NDAI0C03630)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     NDAI_0C03630 (NDAI0C03630)
Mitochondrial biogenesis [BR:ndi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    NDAI_0C03630 (NDAI0C03630)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 11494768
NCBI-ProteinID: XP_003669266
UniProt: G0W8B2
Position
3:complement(832525..833994)
Genome map
AA seq 489 aa AA seqDB search
MSQAKSIDHVIKALPKLQSRYNIFAHLEPSTKILQRYNDIQKNQPNSTLAGTISAIKDNI
VTQDSNTTCASQMLKEYKSPFTATIVKLLSNAGTTIVGKTNMDEFAMGSLGIHSCYGPTI
NPSRAFFANDDMGKREMVTGGSSSGSAAAVSATIDGDNIIDFALGTDTGGSVRLPASYCS
VLGFKGSYGRISRYGVVSFAQSLDTVGIFAKDLPILRGVFDVLNKYDRKDPTSLNDLLRN
EIIELSDKCLHRLQNPLRIGIVQEFNQESVDKDIKSAFHDFIGQLMEKGYTVVPISIPSI
KYSLPIYYTLAPSEAVSNLSRYDGIRFGTRDPNEDVNNEAFFSKTRSNFGTEVRNRLILG
NYNLSSSFAHNNYIQAQKLRVNLINEFDFMFKFPNVLTRNKANVGDDNGIDFIISPTSLN
KPTFVRRAMSDKIATDEYFNDIFTIPASLAGLPTMTIPIRGNEPIGIQIMGQYGDDQGVL
DFTSTLMKK
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaagcaaaatcaattgatcatgtcataaaagctctcccgaagctacaatctcgg
tacaatatttttgcacatttagaaccatcaacgaagatccttcaaagatataatgatatt
caaaaaaatcaaccaaattctacccttgcaggtaccatatctgccatcaaggataatata
gtaactcaagatagtaatacgacgtgtgcttctcaaatgttaaaagagtataaatcgccc
tttactgcaactatagtgaaattattaagtaatgcagggactacaattgttggtaagact
aatatggatgaatttgcaatgggatcgctcggtattcattcatgttatggtcctacaatt
aatccctcgagagcattttttgcgaatgatgatatgggtaagagagagatggtcactggt
ggttcatctagtggttctgctgctgcagtgagtgcgacaattgatggagataacatcatt
gattttgccttaggtacagatacaggtgggtctgttcgattaccagcttcatattgttct
gtactgggatttaagggatcgtatggacgtatttcaaggtatggtgtcgtttcatttgct
caaagtttagatacggttggcattttcgctaaagatttaccaatcttaagaggtgtattt
gatgtacttaataaatatgatcgaaaggatccaacatctttgaatgatctgttaaggaac
gagattattgaattgtcagacaaatgcttacatagattacaaaacccattgcgaattggt
atagtacaagaatttaaccaagaatccgttgataaagatattaagagtgcgttccatgat
ttcatcggacaactcatggagaagggctatactgtagttccaatttcaataccatccatt
aaatattctttaccgatatactatactttagcaccttcggaagcagtatccaatctatct
agatatgatggaatcagatttggcacacgagaccctaacgaagatgttaataatgaagcg
tttttctccaagacaagatctaattttggtacagaagtgcgaaacaggttaatactgggg
aattataatttaagttctagttttgctcataataattatattcaagctcaaaaattacgt
gttaatttaattaatgaatttgatttcatgttcaaatttccaaatgttttaactagaaat
aaagcaaatgttggtgatgataatggaattgattttatcatcagtcccacatcattaaat
aaaccaacttttgtcagaagagctatgagcgataaaattgctactgatgagtatttcaat
gatatatttactattccagcatctttagcaggattaccaaccatgactattccaataaga
ggcaatgaaccaattggaattcaaataatgggacaatatggagatgatcaaggtgttctt
gattttacatcaacattaatgaaaaaataa

DBGET integrated database retrieval system