KEGG   Naumovozyma dairenensis: NDAI_0G01210Help
Entry
NDAI_0G01210      CDS       T02234                                 

Gene name
NDAI0G01210
Definition
(RefSeq) hypothetical protein
  KO
K02365  separase [EC:3.4.22.49]
Organism
ndi  Naumovozyma dairenensis
Pathway
ndi04111  Cell cycle - yeast
ndi04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:ndi00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    NDAI_0G01210 (NDAI0G01210)
   04113 Meiosis - yeast
    NDAI_0G01210 (NDAI0G01210)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ndi01002]
    NDAI_0G01210 (NDAI0G01210)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ndi03036]
    NDAI_0G01210 (NDAI0G01210)
Enzymes [BR:ndi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     NDAI_0G01210 (NDAI0G01210)
Peptidases and inhibitors [BR:ndi01002]
 Cysteine peptidases
  Family C50: separase family
   NDAI_0G01210 (NDAI0G01210)
Chromosome and associated proteins [BR:ndi03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Separase
    NDAI_0G01210 (NDAI0G01210)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_C50 CHAT DUF2833
Motif
Other DBs
NCBI-GeneID: 11497293
NCBI-ProteinID: XP_003671140
UniProt: G0WDN6
Position
7:263427..268373
Genome map
AA seq 1648 aa AA seqDB search
MSKTEDPLNEISRNGSSQAKINSFLTNSGKTNNRNHTSKPVHIYDLKQGKENWPIVISHD
IEKNYNLITEFLKESNVQRHRIDQIHDIFTFMYSELVKSHLLRQLQTLSKQHLMLIVKLM
NANELEYSQKEIFLLYNATNLIKIEDWEGILLADFNCNNRHYLSTLKILSLQLLLKKKLY
VTYHETIIELFSHDDRYLLQDPKLKIHTIIKLVLNMFSVLPNYKILFGLKFLQYIKQFNL
SFETYLKNMVQTTFEKQLLNYSVKSFHSCKYFLNSFYLKYSKYNTQLNKIMLRSLIPNVD
NIVSNGLFLTELKRNSDFNISCCCFTHDQMNEFVTNVEKFINNKESIQNSAWLTTMNSIW
KLVKNENFEKNKRILTIFDKLLNALNSNIIAYKNCENELIPLIETLIQFCNDIQESRRIS
NIINVLFNCSVVLKNYKFLEMAAKLEILKYLASDNQPDQWKMIATKFEKFISSTSNHEHK
LALFSYIFNVYVLTDKFNLPMILDFCQTLFLRCFSRLKLTHFIQFKHCSELMLVIVYSNS
SILTIPYQDWSILSQMLFFCINGNFELTPLDINNNSNKNQYLYHYEVLIKSAYILNIDMK
RHSTNNLLLLTRSFIDKWILRLELSQYKERKDDISSFEVNFVKTLFQYLNFNNFHLLIIE
LASAIKNIPEYYPSLIMQTEKWLLESYIDLQFNNRIMDLTNNLVQLVQLDLQNAKLDKLL
PFLKMKSSLFAWENNPTAFERLFIKELPTLRPDIFDTTNKSKLSSSQYVEVLLFNINVLN
DASKLHMFQHDIASSVIENKKALKFATALIKKSDKLSQSSRLSLIKSLSTSFINLIEIFV
QIGLAKDSDFYTKELSKVISELGEPSAVYACLRYLHTYYKLTEQESHATVTLQKANKTFD
YINGEQDIQSLCMFLFDNNECNKIDQSLKLFFGDQIKETFLPQYWKLQMGEQIEEITCLK
KFRAAHLINKLNNIYQHALKSLQEDPFFKGLFESILVIPGISQPNMIKKKAPTYKQLHLF
HDNDGKNDPLTPVKRKLSLSIYDSPRSSNMTPKGKHMKQKFDKVAAIKNLKIIKEAIENL
ELQSLRHHELQKVSSLFSLSLTMLSSINDNLTLDKDFIRALTLADLPKRLPLYYDKILST
VNDGMYRTGNLLPFNPQSMLTSKVELLNDLDPLSFRSNSFTFNIITIDVCSITGNLLLSK
IDPVTKKLNHLSIPLNRGNARDLDTLYLSFKDASMELQNIIEESNRSTSFEVTNLIKTKE
QRKEWWDLRHELDGRLQTLLQNIEYSWFNGFKGIFDTTKINESAFKDFKEKFYEILHQNL
PSRKQLGNPYMFLQIEDWILQAMLKLDPLDKQFLSQMEDLIYCILDILLFHGEENAYDEI
DFSLLHIQLEEQIRRYQSKSLHTSNEIDHTFLIVSNSCHSFPWESLSFMKDLSITRVPSL
QWLSSTLQKWNKDLFGGILVNERISMILNPYGDLNRTEERFRELFKNIATNRPSSKLLIN
EKPDENQFLDMLSNSNLFIYVGHGGGEQYIRAREIKKQDNVAPAFLLGCSSASMKYFGKL
EPTGTVHSYLLGGSPMVVGNLWDVTDKDIDKFSQEVFEKVGFVEMNRSNSKPMNVARAVN
ESRDICHLKYLNGAAPVVFGLPLLFYLE
NT seq 4947 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaactgaagatcctttgaatgaaattagtcgaaatggttcgtcacaagccaag
attaacagcttcctgaccaactctggaaaaacaaataataggaaccatacatcaaaacca
gttcatatttacgatttaaagcaagggaaggagaattggccaattgtaatatctcatgat
attgaaaaaaactacaatttaataacagaatttttaaaggaatcgaatgtgcaacgacat
cgaatagatcaaatacatgacatattcactttcatgtatagtgaattggtaaaatcacat
cttttaagacagttgcagactttgagtaagcagcatttgatgcttatcgtgaagctcatg
aatgctaatgaattggaatactctcaaaaggaaatatttttattatacaatgctacaaat
ctcatcaaaattgaagattgggaaggtatattactggcagattttaattgcaataataga
cattatttatcaacattaaagattttatcattgcaactcctcttaaaaaaaaaattatat
gtgacataccatgaaacaataatagagctgttttctcatgatgaccgatatcttttgcaa
gatccaaaattgaaaatacacacaatcattaaattagtattgaatatgttttctgtactt
ccaaattataagatccttttcggactaaagtttttgcaatacataaagcaattcaatcta
tcatttgaaacttaccttaaaaatatggttcaaacgactttcgagaaacaattactgaac
tactctgtgaagagtttccattcatgtaaatatttccttaattccttctatctaaaatat
tcaaaatataatactcaattgaacaaaataatgttaagatcattgataccgaatgttgat
aatatagtatccaatggtttgtttctcacagaattgaagcgaaattctgattttaatata
tcatgttgttgtttcactcatgaccaaatgaatgaatttgttacaaatgttgagaaattc
ataaataataaggaatccattcaaaactcagcttggttaactacaatgaactctatttgg
aaactagtgaaaaatgaaaattttgaaaaaaataaacgaatattaactatttttgacaaa
cttttgaatgctctgaatagtaatataattgcatataaaaactgtgaaaatgaattgata
ccgttaatcgaaactttaatccaattttgcaacgacattcaagaatcaaggagaatctca
aatataataaatgtcttatttaattgttctgtcgttttgaaaaattacaagttcctagaa
atggcagccaaattagaaattttgaagtatttggcttctgacaaccaaccagatcaatgg
aagatgatagccaccaaattcgaaaagtttatatcaagtacctcgaatcatgaacataag
ctagcattgttttcttacatatttaatgtctatgttcttactgataagttcaaccttcca
atgattcttgatttttgtcaaacactttttcttcgttgtttctctcgattgaaattaact
cattttattcaatttaaacattgctcggaacttatgctagtcatagtatatagtaactcc
tcgatccttaccataccgtatcaagattggtccattctttcacaaatgttgtttttctgt
ataaacggtaactttgaattaactccgttagatatcaataacaattcgaataaaaaccaa
tacctttatcattatgaagttttaatcaaatcggcatatatccttaatatcgatatgaaa
agacattccacaaataatctccttctcttaacgagatcatttatcgataaatggatattg
agacttgagttgagtcaatacaaagaaaggaaagacgatatatcctcatttgaggtcaat
tttgtcaaaactttgtttcagtatttaaatttcaataatttccatttattaattattgag
ttagcatctgcaataaaaaatataccggaatattatccctctctaatcatgcaaaccgaa
aaatggttattagaatcttatattgatttacaattcaacaataggataatggacctgact
aacaatctcgtgcaattagtacaactagatttacaaaatgccaaactcgataagctgtta
ccatttttaaagatgaaatcaagtttgtttgcatgggaaaacaatccaactgcatttgaa
agattatttataaaggagctaccaacattaagacctgatatcttcgatactactaataag
tccaaattatcatcttcacaatatgttgaagtgttattattcaatatcaatgtgcttaac
gatgcgtcaaaactacatatgtttcaacatgatatcgcctcttcagttatcgagaataag
aaagctttgaaattcgccactgcattgattaaaaaatcggataagttatctcaatcctca
agattatcattaattaaatcattgtcaacgagctttattaatttaattgaaatctttgtt
caaataggtttagctaaggattctgatttctacaccaaagaattatcaaaagtgatctcc
gaattaggtgagccatcagctgtttacgcttgtctacgatacttacacacatattataaa
ctaacagaacaagagtcacatgcaacagttactttacagaaagctaacaagacatttgat
tacattaatggtgaacaagatatacaaagcttatgcatgtttcttttcgataataatgaa
tgtaataagattgaccaatctttaaagctattttttggtgatcaaataaaagagacattc
ttaccacaatactggaaattgcaaatgggagaacaaatagaagaaatcacatgtctaaaa
aaattcagagcagcacatcttatcaacaagttaaacaatatttatcaacatgctttaaag
agcttgcaagaagatccattcttcaagggactttttgaatcgatactggtcatccctggg
atatcacaaccaaatatgattaagaaaaaagcacccacatataagcagctgcatttattt
catgataatgatgggaaaaatgatcccttaaccccggtgaaaaggaagctctctttaagt
atatatgattcaccgcgttcttccaatatgactccaaagggtaagcatatgaaacaaaaa
tttgacaaagtagctgcaattaaaaatcttaaaataatcaaagaagcgatcgagaattta
gaattacaatctctaaggcatcatgagctccagaaggtatcgtcattattttccttgagc
ttgacgatgttatccagtataaatgataatttgactctggacaaagattttatcagggca
cttactttagcagatttgcccaaaaggttgcctttatattatgataagattttgtcaacg
gtaaatgacggaatgtatcgcaccgggaatttgctaccatttaatcctcaatcaatgttg
acgagtaaagtagaattattaaacgatctcgaccctttgagtttccgttctaattccttt
acgtttaatattattaccatcgatgtatgctcaatcactgggaatttattactctcgaaa
atcgatcctgttacgaaaaaattgaatcatttaagcatcccattgaatagaggtaatgca
agggatttggatacgttgtatttaagcttcaaagatgctagtatggaattgcaaaacatt
atagaagaaagtaacagaagcacatcatttgaagtcacaaatttgatcaagacaaaagag
caaaggaaagaatggtgggacttacgtcatgaacttgatggtagattacaaacattatta
caaaatattgaatattcatggtttaatggattcaagggaattttcgatacaacaaagatt
aatgagagtgctttcaaagactttaaagaaaagttttacgagattttgcatcaaaatctg
cctagtcggaaacaattagggaacccatacatgtttttacaaatcgaggattggattttg
caagcaatgttgaaattggaccccctggacaaacagttcttatcacaaatggaagatttg
atttattgtatacttgatattcttctcttccatggtgaagaaaacgcatatgatgagatc
gatttcagtcttcttcatatacaattagaagaacaaatcagaagatatcaatcaaaatcg
ttacacacttcaaatgaaatagaccatactttcctaatcgtaagtaactcctgtcattca
ttcccatgggaaagtttatcttttatgaaggatctctcaatcacaagggtgccatctcta
caatggttaagttcaacattacaaaaatggaataaggatttatttggaggaatcttggtc
aatgaaagaatatcgatgattcttaatccatatggcgatttaaaccgaacagaagaacga
ttccgggagttgttcaaaaatatagcgaccaaccgtccaagctccaaattattaatcaat
gaaaaaccagacgagaatcaatttttagatatgttgtcgaacagtaatttattcatttat
gtgggtcatggcggtggtgaacaatatatacgtgccagagaaattaagaaacaggacaat
gtagcaccggctttcctactaggatgttcatcagcgtcgatgaaatattttggtaagtta
gaacctactggaacggttcattcgtacttactaggtgggagccctatggttgttgggaat
ttgtgggacgtcacagataaagatattgataaatttagtcaagaagtgtttgagaaagtt
gggtttgtggaaatgaaccgaagcaattcaaaaccaatgaatgttgcaagagcagttaat
gaatcgagagatatctgtcatttgaaatatcttaatggagcagctcctgttgtttttgga
ctaccgttactattttatttagaataa

DBGET integrated database retrieval system