KEGG   Naumovozyma dairenensis: NDAI_0G05540Help
Entry
NDAI_0G05540      CDS       T02234                                 

Gene name
NDAI0G05540
Definition
(RefSeq) hypothetical protein
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
ndi  Naumovozyma dairenensis
Pathway
ndi00220  Arginine biosynthesis
ndi01100  Metabolic pathways
ndi01110  Biosynthesis of secondary metabolites
ndi01130  Biosynthesis of antibiotics
ndi01230  Biosynthesis of amino acids
Module
ndi_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:ndi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    NDAI_0G05540 (NDAI0G05540)
Enzymes [BR:ndi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     NDAI_0G05540 (NDAI0G05540)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-GeneID: 13927007
NCBI-ProteinID: XP_003980213
UniProt: J7RTH2
Position
7:1364645..1365634
Genome map
AA seq 329 aa AA seqDB search
MTTDYNNNNIRHLISIKDLSDEEFKILVDRAQHYKQIFKSNDTTEFQKNHLKLLGRTIAL
IFTKRSTRTRISTEGAATFFGAQPMFLGKEDIQLGVNESFYDTTKVVSSMVSCIFARVNS
HDDIKALCKDSSVPIINSLCDTYHPLQAICDMLTIREHLGDKKDKLKITWIGDANNVIND
MALAAMKLGMDVSIATPNGIEMDQFIVDAASEVSKRNGTKLELTHDSKAASKGANVLVTD
TFVSMGEEYAKEAKLKQFSGFQINQELADLADDDFRFMHCLPRHHEEVTDDVFYGKHSIV
FDEAENRLYAAMAAIDVFVINKGSFNDLK
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgactactgattacaataacaataacatccgccatctaatctctatcaaagatttgtct
gacgaagaatttaaaatactagttgacagagctcaacattacaaacagatcttcaaatca
aatgacaccacagaattccaaaagaatcatttgaaactacttggcagaacaatcgctcta
atcttcaccaagagatccaccagaacaagaatctccactgaaggtgctgctactttcttt
ggtgctcaaccaatgtttctgggtaaagaagatattcaattaggtgtcaatgaatcattt
tacgataccactaaagtcgtatcatccatggtttcatgtattttcgctcgtgttaattct
catgatgacatcaaggctctttgtaaagattcttctgtaccaatcattaactccctatgt
gatacttatcatccattacaagctatctgtgatatgttgaccattagagaacatctaggc
gacaagaaggacaaattaaaaatcacttggattggtgacgctaataatgtcattaacgat
atggccttggctgctatgaaattaggtatggacgtttccattgctactccaaatggtatc
gaaatggatcaatttatagtcgatgctgcctctgaagtatccaagagaaacggtaccaag
ttagaattgactcatgattctaaagctgcctctaagggagctaatgtgttggttactgat
actttcgtgtcaatgggtgaagaatacgctaaagaggctaaattgaaacaattcagtggg
ttccaaatcaatcaagaattggcggatttggctgatgatgattttagattcatgcattgt
ttaccaagacaccatgaagaagttactgatgatgtgttctatggtaagcattctattgtc
tttgatgaagctgaaaatagattgtatgctgctatggctgccattgacgttttcgtcatt
aataagggtagtttcaatgacttgaaatga

DBGET integrated database retrieval system