KEGG   Naumovozyma dairenensis: NDAI_0H02060Help
Entry
NDAI_0H02060      CDS       T02234                                 

Gene name
NDAI0H02060
Definition
(RefSeq) hypothetical protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
ndi  Naumovozyma dairenensis
Pathway
ndi00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:ndi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    NDAI_0H02060 (NDAI0H02060)
Enzymes [BR:ndi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     NDAI_0H02060 (NDAI0H02060)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     NDAI_0H02060 (NDAI0H02060)
    1.1.1.-  
     NDAI_0H02060 (NDAI0H02060)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C Pyr_redox DAO FAD_binding_3 ADH_zinc_N_2 Pyr_redox_3 Sacchrp_dh_NADP NAD_binding_7
Motif
Other DBs
NCBI-GeneID: 11495911
NCBI-ProteinID: XP_003671623
UniProt: G0WF19
Position
8:complement(502872..504071)
Genome map
AA seq 399 aa AA seqDB search
MRALAYFGKNDIKFTNDLPEPKITAPDELIIDISWCGICGTDLHEFQDGPIFFPENGCCH
EISGEGLPQAMGHEIAGIVSEIGPKVKKFQVGDRVVVEPTGTCKDRYRWPDAPNANQEEC
AACKKGLYNICSNLGLVGCGVQSGGFAERMVMNEAKCYKIPEHLTMDVAALIQPIAVSWH
AVRVSKFKPGSSVLIIGGGPIGLGTILALNGHGVTEVVVSEPAKIRRDLAEKMGAVVYDP
MTRDHDESIKYLRSIAPGGDGFDYTFDCSGNPATLKAAIECLTFRGTAVNVAIWGKNPVS
FLPMDLTHQEKSYTGSMCYTYHDFEAVIKAFEERRIDEEKAKHMITGRVPIENGVKDAIL
RLITHKEQTIKIILTPNNNNELGDEPEQKKKSQLIKSKL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgagagcattagcgtacttcggaaaaaatgatattaaattcacaaacgatctaccagaa
ccaaagataacagcaccagacgaactaataatcgacatctcatggtgtggtatctgtggt
acagatctacatgaattccaagatggacccatcttcttcccagaaaatggttgttgtcat
gaaatttcaggtgaaggtttaccacaagcaatgggtcatgaaatagcgggtatagtctca
gaaatcggtcccaaggtaaaaaaattccaagtaggtgatcgtgtcgttgtggaaccaact
ggtacatgtaaagatagatatcgttggccagatgcccccaatgcaaatcaagaggaatgt
gcagcttgtaaaaaaggcctttataatatttgttccaatctggggttagtaggttgtggt
gtacaaagtggtggcttcgcggaaagaatggttatgaatgaggcaaaatgttataagatc
ccagaacatttaactatggatgttgcagctttgattcaaccgattgctgtttcatggcat
gcggttagagtttctaaatttaaacctggttcttcagtattgattattggtggtggacca
attggattaggtacgattttagctttgaatggtcatggtgtcactgaagtggtggtatct
gaaccagctaagattagaagggatcttgctgaaaaaatgggcgctgtagtctatgatcct
atgactagagatcatgatgaatctattaaatatttaagatctattgctccaggtggtgat
ggtttcgattacacttttgattgttctggtaatccagctactttaaaagctgctattgaa
tgtctgacatttagaggtactgcagttaacgttgccatttggggtaaaaaccctgttagt
ttcttaccaatggatctaactcatcaagaaaaaagttatacaggttccatgtgttacact
tatcatgattttgaagctgttattaaagcctttgaagaaagaagaattgatgaggaaaag
gcaaaacatatgataacaggtcgtgttccaattgaaaatggggttaaagatgctatcttg
agattaataacgcataaagaacaaaccattaaaattattttaactccaaataataataac
gaattaggcgatgagcccgaacaaaaaaaaaaaagtcaattaataaaatctaagttgtaa

DBGET integrated database retrieval system