KEGG   Naumovozyma dairenensis: NDAI_0I02880Help
Entry
NDAI_0I02880      CDS       T02234                                 

Gene name
NDAI0I02880
Definition
(RefSeq) hypothetical protein
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
ndi  Naumovozyma dairenensis
Pathway
ndi00071  Fatty acid degradation
ndi00410  beta-Alanine metabolism
ndi00592  alpha-Linolenic acid metabolism
ndi00640  Propanoate metabolism
ndi01040  Biosynthesis of unsaturated fatty acids
ndi01100  Metabolic pathways
ndi01110  Biosynthesis of secondary metabolites
ndi01212  Fatty acid metabolism
ndi04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ndi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    NDAI_0I02880 (NDAI0I02880)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NDAI_0I02880 (NDAI0I02880)
   00592 alpha-Linolenic acid metabolism
    NDAI_0I02880 (NDAI0I02880)
   01040 Biosynthesis of unsaturated fatty acids
    NDAI_0I02880 (NDAI0I02880)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NDAI_0I02880 (NDAI0I02880)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    NDAI_0I02880 (NDAI0I02880)
Enzymes [BR:ndi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     NDAI_0I02880 (NDAI0I02880)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_ox_N Acyl-CoA_dh_1
Motif
Other DBs
NCBI-GeneID: 11493867
NCBI-ProteinID: XP_003672099
UniProt: G0WGE5
Position
9:complement(679180..681465)
Genome map
AA seq 761 aa AA seqDB search
MTRLSTVNTKDSPVLIPQKLINKERQDSKLQIDEINTFLESNPEKQSLTHQLIDQIVNDP
ILQTDTKYYDQTKDQQREITAKKIARLATYMEHDIKTVRAQFRDNDLIKQLQSSSSSSVL
PLTNKDISLFDKRLSLVANIDPQLGTRVGVHLGLFGNCIKGNGTDEQIKYWLQTRGAAFI
KGIYGCFSMTELGHGSNVAQLQTTATYDSKLDSFVINTPDLTATKWWIGGAAHSATHTVC
YARLLVEGKDYGVKTFVVPLRDLETLQLLPGISIGDIGSKMGRDGIDNGWIQFRNVIIPR
EYMLSRFTKVIPSENGSDKVTVKTQPQLDQISGYSALLSGRVNMVMDSFRFGSKFATIAT
RYAVGRQQFAPNKNSTELQLIDYPLHQYRVLPQLTIPYLVSPAAFKLMDTYYSTLDELYK
VSSSSPANANGLKVVSEKLKNLFIDSASLKATNTWLISTLIDELRQTCGGHGYSQYNAFG
KGYDDWVVQCTWEGDNNILSLTSAKSILKKFVDSATKGKFNNSLDEDSFNYLNPKFIMKV
FTPSGDSTSIIDDDDLYSYTKIWEVSLVKILAFIGKSIERSRDVDSVSKLLVMVSKFHAI
HSMLKTYHNKLTNNDPHDKSFINDQYTQETMWNIYKLFSIYFIDKHSGEFQQFKILTPND
ISKIIQPKLLELLPKLRKDCIALTDSFKLPDAMINAPIGYYDGDIYHNYFNEVVKNNPVE
KDGAGIAPYHKILSDMLTRGFEFDAKLGGSSNKDILSMLNK
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
atgacaagattatcaacagtaaacacaaaggactctcccgtcttgatcccacaaaaatta
ataaacaaagaaagacaagattctaaactacaaatcgatgaaataaatactttcttagaa
tcgaacccagaaaaacaatccctaactcatcaactaatagatcaaatcgtcaatgatcca
atcttacaaacagacaccaaatattacgatcaaacaaaggaccaacaaagagaaattaca
gcaaagaaaatagcaagattagccacatacatggaacatgacatcaaaacagttagagct
cagttccgtgacaatgacctgatcaaacaactccaatcttcatcttcttcctctgtcctt
cctttgacaaataaagacatctcattatttgacaagcgtctatctctcgtagcaaacata
gaccctcaattaggtacaagagttggtgtccatttaggactattcggtaattgtataaaa
ggtaacggtacagatgaacaaatcaaatattggttacaaacgcgtggtgccgcattcata
aagggaatatacggttgtttctccatgactgaactaggtcacggttctaatgtggctcaa
ttacaaactacagctacttatgattctaaattggattcattcgtgataaatactccagat
ttgaccgcaacaaaatggtggattggaggtgctgctcattctgcaactcataccgtttgt
tacgcaagattactcgtagaagggaaagattacggtgttaagacattcgtggtcccattg
agagatttggaaactttacaattgttacctggaatctccattggtgatattggatccaag
atgggtagagacggtattgataatggatggattcaatttagaaacgttatcatcccaaga
gaatatatgttaagtagatttactaaagtaattccctctgagaatggtagtgataaagtt
actgtcaaaactcaacctcaattggatcaaatttcaggttatagtgctttgttaagtggt
agagttaatatggttatggactcttttagattcggttccaaatttgctactatcgctaca
agatatgccgtaggaagacaacaattcgctccaaataaaaactctacggaattacagttg
atcgattatccattacatcaatatcgtgtcttaccacaattgactataccatatttggtt
tctcccgctgcgttcaaattgatggatacttattattctacattagatgaattgtataaa
gtttcatcttcatctcctgctaacgctaatgggttgaaagttgttagtgaaaaattgaag
aatttgttcattgatagtgcatcattaaaggcaactaatacttggttgatctctactttg
attgatgaattaagacaaacttgtggtggtcacggttattctcaatataatgctttcggt
aaagggtatgatgattgggttgttcaatgtacttgggaaggtgataacaatatcttatct
ttaacttctgctaaatccattttgaaaaaattcgttgattccgcaacaaagggtaaattt
aacaattcattagatgaggattcattcaattatttaaatccgaaatttatcatgaaagtt
ttcaccccatctggtgactctacaagtattatcgatgatgatgacctttatagttacacc
aaaatttgggaagttagtttggttaagattttagctttcattgggaaatcgattgaaaga
tctagagatgttgatagtgtttcgaaattattagttatggtttcgaaattccatgctatt
cattccatgttaaaaacatatcataataagttaacaaataatgatccccatgataagtca
ttcattaacgatcaatatactcaggagacaatgtggaacatttataaattgttctccatc
tatttcatcgataaacattctggtgaattccaacaatttaagatcttaacaccaaacgac
atctccaaaatcattcaaccaaaattattagaattgttaccaaaattaaggaaagattgt
atcgctttgactgattcattcaaattacctgatgcaatgattaatgctccaattggctat
tacgacggtgatatctatcataattatttcaatgaagtcgtaaagaataatcctgtggag
aaagatggtgccggtattgctccttatcataagattttatccgatatgttgacaagagga
tttgaattcgacgctaaattaggaggtagttcaaataaagatattttatccatgttgaac
aaatag

DBGET integrated database retrieval system