KEGG   Naumovozyma dairenensis: NDAI_0J00420Help
Entry
NDAI_0J00420      CDS       T02234                                 

Gene name
NDAI0J00420
Definition
(RefSeq) hypothetical protein
  KO
K15562  serine/threonine-protein kinase BUR1 [EC:2.7.11.22 2.7.11.23]
Organism
ndi  Naumovozyma dairenensis
Brite
KEGG Orthology (KO) [BR:ndi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ndi01001]
    NDAI_0J00420 (NDAI0J00420)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ndi03021]
    NDAI_0J00420 (NDAI0J00420)
Enzymes [BR:ndi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     NDAI_0J00420 (NDAI0J00420)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     NDAI_0J00420 (NDAI0J00420)
Protein kinases [BR:ndi01001]
 Serine/threonine kinases: CMGC group
  CDK family
   NDAI_0J00420 (NDAI0J00420)
Transcription machinery [BR:ndi03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    BUR kinase complex
     NDAI_0J00420 (NDAI0J00420)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 11494035
NCBI-ProteinID: XP_003672177
UniProt: G0WGK6
Position
10:73312..75606
Genome map
AA seq 764 aa AA seqDB search
MADSKTDISVNTEEMKSPISHANASYSSEFKYKIGKVKQTPVVQTDPKTGLTFIELKARP
NEKVYGCTTFANNYREDKKLGRGTFGEVYKGIHLATQRQVAMKRILVNVEKDLFPITAQR
EITILKKLNHKNILKLLEMVYDYPPDSSSSSSSSSLSSKNNKKESPSSQNDPKFFYMILP
YMVSDLSGILHNPRVNLEMKDIKNMMLQLLEGVNYIHCQKFMHRDIKAANILIDHKGIIK
LADFGLARVYYGSPPNLKYPGGAGSGAKYTSVVVTRWYRAPELVLGDKHYTTAVDIWGVG
CVFAELFEKKPILQGSTDIDQGHVIFKLLGTPTEEDWKLAKYLPGAELTKTTYKSTLEER
FGKWLDKTGLDFLRQLLALDPYKRLTAMSAVRHPFFKEEPLPSGQLSLPCEESHEADIKR
YKEEMHQAMSLKAPSAPQGHLVEKSNPSSTRVSVAHNGSVLERKQIPTGPGPKQSKAELP
PKPSTEMEYKPPMPTGSRLGPSRYSQNKINQRPNQDYRNNYINPSHHNENTRSTQGSYFQ
HSSNTSAELPRKRSYSNDKNNNYGLPSRPANVRPHPHLASPSGRGLPQKPPALQINSRYN
AVPNFNNTISAQKKPQPPTGPARIPPRGPISRYSGTSANSLKIESPPHKKQDISREEKHA
PSKDNGGSLFSRIGVSEQYEARQQQRRNSRQYNNNDQAPSSHKNGYHIQPPPPQQQNPNY
GWANTKKQAGDNSSTRKHNTNNNQGIHPKYIEDDSGNEDIADLY
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atggctgattctaagactgacatatcggtaaatacggaagaaatgaagtccccaataagt
catgccaatgcttcttattcatctgagttcaaatataagattggtaaagtcaaacaaact
cctgtagttcaaactgatcctaaaacaggcctcacatttatagaattgaaagcaaggcct
aatgagaaagtttatggttgtaccacttttgctaacaattatagagaagataagaaacta
ggtcgagggacatttggtgaagtttataaaggtatccatttagccactcagagacaagtt
gccatgaagagaatattagttaatgttgaaaaggatcttttccctatcacagctcaacgt
gagattacaatacttaaaaaactgaatcacaaaaacatattgaaactattagaaatggtc
tatgattatccacctgattcatcgtcatcttcctcctcctcttcattatcgtctaaaaac
aacaaaaaagaatcaccatcaagtcagaatgaccccaaattcttttatatgattctccca
tacatggtttctgatctatcaggtatattacataacccaagagtaaacttggaaatgaaa
gatattaaaaatatgatgctacaattattagaaggggtgaattatattcattgtcaaaaa
ttcatgcatagagatattaaagctgcaaatattcttatagatcataaaggtataataaaa
ttagcagattttggtttagcaagagtttattacggttcacctccaaatttgaaatatcca
ggtggcgccgggtctggtgccaaatatacgtcagtcgttgtgacgagatggtatagagct
ccagaattagtattaggcgataaacattatactacagcagtcgatatttggggagttggt
tgtgttttcgcggaattgtttgaaaagaaacctatacttcaaggttctaccgatattgat
caggggcatgttatattcaaactattgggtaccccaacggaggaagattggaaactagct
aaatacttaccaggtgcggaattaacaaagacaacttataagagtacattagaagaaagg
ttcggtaaatggctagataagaccggattagacttcttaagacaactattagcattagat
ccttataaaagattgacagcaatgtctgctgttaggcatccctttttcaaggaagaacca
ttaccttctggacaattaagtttaccttgtgaggaaagccatgaagcagatattaaacgg
tataaagaagaaatgcatcaagcaatgtcgttaaaggcaccttcagctcctcaaggtcat
ctagtggaaaaatctaatccgtcatcaacaagagtttcagtagcacataatgggtctgtt
ttggaaaggaaacaaataccaacaggtccaggacccaaacaatctaaagcagaattaccg
ccaaaaccttcaacagagatggaatataaacctcctatgccaacaggttccagactaggt
ccctcacgttattctcaaaataaaatcaaccaaagacccaatcaagattatcgaaataat
tatatcaatccctcccatcataatgaaaatacacgtagcacgcaaggttcttattttcaa
catagtagtaatactagtgcggaattgccaagaaaacgttcatacagtaatgataagaat
aataactatggactaccaagcagaccagccaatgttagacctcatcctcatctagcttct
ccttcaggaagaggactaccacaaaaaccacctgctctacaaataaatagtcgatataat
gcggtgccaaacttcaataatacaatatcggcacaaaagaaacctcagcccccaactgga
ccagcgagaataccaccaaggggaccaatatccagatattcaggcacttctgcaaacagt
ttaaaaatagagtcaccaccacataaaaagcaggacatttcaagggaggaaaagcatgct
ccctccaaggataatgggggctctcttttcagtagaattggtgttagtgaacagtatgaa
gcaagacaacaacagagaaggaattcaaggcaatacaataacaacgaccaggcgccttca
tcgcataagaacggatatcatatacaacctccaccaccacagcagcaaaatccaaattat
ggttgggcaaacactaaaaaacaggcaggagacaatagtagcacaaggaaacacaacacc
aacaataatcaaggaattcacccgaagtatatagaagatgattctggaaatgaagatatt
gcggacctatattga

DBGET integrated database retrieval system