KEGG   Nocardioides dokdonensis: I601_1414Help
Entry
I601_1414         CDS       T04431                                 

Gene name
hdl_IVa_1
Definition
(GenBank) (S)-2-haloacid dehalogenase 4A
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
ndk  Nocardioides dokdonensis
Pathway
ndk00361  Chlorocyclohexane and chlorobenzene degradation
ndk00625  Chloroalkane and chloroalkene degradation
ndk01100  Metabolic pathways
ndk01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ndk00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    I601_1414 (hdl_IVa_1)
   00361 Chlorocyclohexane and chlorobenzene degradation
    I601_1414 (hdl_IVa_1)
Enzymes [BR:ndk01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     I601_1414 (hdl_IVa_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_like HAD_2
Motif
Other DBs
NCBI-ProteinID: ANH37850
UniProt: A0A1A9GJJ7
Position
complement(1469467..1470138)
Genome map
AA seq 223 aa AA seqDB search
MIITFDLFSALTDTRSGASVTFAEIAGERGWPLAGADVYDAWDARNKALQREARAPVTFR
DVSGEALALAYADLGLDVADPIGEDLARLHASIPDWPLWPDVADAIARVAQHARVGLLSN
VDDDLARLTRAHALVDPRLVLSSQRLGAFKPAPEIYRAAAAAVAPQRLVHVAASARDVRG
ALEAGITTIRLARPGHAVDPEGPQPPLEAQDAADLAGLLATLD
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgatcatcaccttcgatctcttctcagccctgaccgacacccgcagcggcgcgagcgtg
acgttcgccgagatcgccggtgaacgaggatggccactcgcaggcgcggacgtgtacgac
gcctgggacgcgcgcaacaaggcgctccaacgcgaggcacgagcgcccgtgacgttccgc
gacgtgtccggcgaggccctggcgctggcgtacgccgacctgggtctcgacgttgccgac
cccatcggtgaagacctggcgcggctgcacgcctcgatccccgactggccgctgtggccg
gacgtcgccgacgcgatcgcccgggtggcgcagcacgcgcgggtcgggttgctgtcgaac
gtcgatgacgacctggcccggctcacccgcgcacatgcgctcgtggacccccggctggtg
ctgagctcccagcgccttggggccttcaagcccgctccggagatctaccgggcggctgcc
gcggcggtcgctccccagcggctcgtgcacgtcgctgcctcggcacgcgacgtgcgcggt
gcgctggaggccgggatcaccacgatccggctggcccgtcccgggcacgctgtggacccg
gagggcccgcagccccctctcgaggcacaggatgccgcggacctggcggggctgctcgcc
accctcgactga

DBGET integrated database retrieval system