KEGG   Nocardioides dokdonensis: I601_2698Help
Entry
I601_2698         CDS       T04431                                 

Gene name
ltaA
Definition
(GenBank) L-allo-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
ndk  Nocardioides dokdonensis
Pathway
ndk00260  Glycine, serine and threonine metabolism
ndk01100  Metabolic pathways
ndk01110  Biosynthesis of secondary metabolites
ndk01120  Microbial metabolism in diverse environments
ndk01130  Biosynthesis of antibiotics
ndk01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ndk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    I601_2698 (ltaA)
Enzymes [BR:ndk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     I601_2698 (ltaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP Aminotran_3 DegT_DnrJ_EryC1 DUF4072
Motif
Other DBs
NCBI-ProteinID: ANH39114
UniProt: A0A1A9GLG3
Position
2810111..2811103
Genome map
AA seq 330 aa AA seqDB search
MIDLRSDTVTKPTESMRAAMARAEVGDDVYGEDPTVLDLEEHVAGLLGHEAALFMPTGSM
ANVLAVRALVEPGQEVLCEASAHIARAELGAHAAISGLTMRTWIHPRGQLDLGAVASLVA
PDMGPFFVRTAAVSVENTHNFAGGTVLPMSDLRDLRELADGAGIAVHMDGARLWNAHVAT
GTPLAEYGAVADTMAVCLSKGLGAPVGSLMVGSADAMVEARVRRKRMGGGMRQVGILAAA
GRHALDHHLDRLADDHEHARLLAEACGVDPAGVDTNIVVVPHDDAPDFVARAADAGVRVA
TVGPRTVRLVTHLGVTRADAEKAAAVLAGL
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacctccgcagcgacaccgtcacgaagccgaccgagtcgatgcgggccgccatg
gcccgcgccgaggtgggcgacgacgtgtacggcgaggacccgaccgtcctcgacctcgag
gagcacgtcgcggggctgctcggccacgaggcggcgctgttcatgcccaccgggtcgatg
gccaacgtgctggccgtgcgcgccctggtggagcccggccaggaggtgctgtgcgaggcc
tccgcgcacatcgcgcgggccgagctcggcgcccacgccgcgatctccgggctgaccatg
cgcacctggatccacccgcgcgggcagctcgacctcggcgccgtggcctcgctggtcgcc
ccggacatgggcccgttcttcgtgcgcaccgcggcggtctcggtcgagaacacccacaac
ttcgcgggcggcacggtgctgccgatgagcgacctgcgcgacctgcgcgagctcgctgac
ggcgccggcatcgccgtgcacatggacggcgcccggctgtggaacgcccacgtcgcgacc
ggcaccccgctggcggagtacggcgccgtcgccgacacgatggcggtctgcctgtccaag
ggcctcggcgccccggtcggctcgctgatggtcggcagcgccgacgccatggtcgaggcg
cgggtgcgccgcaagcggatgggcggcgggatgcggcaggtcggcatcctggccgcggcc
gggcggcacgccctcgaccaccacctcgaccggctggccgacgaccacgagcacgcccgg
ctgctggccgaggcctgcggcgtcgaccccgccggcgtggacaccaacatcgtggtcgtg
ccgcacgacgacgcccccgacttcgtcgctcgcgccgccgacgccggcgtccgggtggcc
accgtcgggccgcggacggtgcgcctggtgacccatctcggagtcacgagggccgacgcc
gagaaggccgcggcggtgctggccggcctctga

DBGET integrated database retrieval system