KEGG   Nocardioides dokdonensis: I601_3469Help
Entry
I601_3469         CDS       T04431                                 

Gene name
hsaD_2
Definition
(GenBank) 4,5:9,10-diseco-3-hydroxy-5,9, 17-trioxoandrosta-1(10),2-diene-4-oate hydrolase
  KO
K16050  4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase [EC:3.7.1.17]
Organism
ndk  Nocardioides dokdonensis
Pathway
ndk00984  Steroid degradation
ndk01100  Metabolic pathways
ndk01120  Microbial metabolism in diverse environments
ndk01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ndk00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    I601_3469 (hsaD_2)
Enzymes [BR:ndk01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.17  4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase
     I601_3469 (hsaD_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Thioesterase Esterase Ndr
Motif
Other DBs
NCBI-ProteinID: ANH39875
UniProt: A0A1A9GR10
Position
complement(3635083..3635985)
Genome map
AA seq 300 aa AA seqDB search
MTPDSVRRSASVHTEATGQISLTYYEAGEPTDVGAGLPLVMLHGGGPGASSWSNFGPALP
GFAESFRTLLVDQPGFGGSDKPPVVGNYYRFAADAVVALLDELGIERVHLLGNSLGGGTA
VRLALSHPDRVGRLVLMGPGGLSLNLFHADPTEGVQRLMEFGGDPTPERLRAFISTMVVD
QSLVTDELVAARFADATSPGAQDAMRSMGMSFWNPETAEDGMLWREAHRLRQHTLLTWGR
EDRVNPLDGAMAALKLIPRARLHVFPNCGHWAQIEAAEEFREVATAFLGRHVERPRRTSA
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
gtgacccctgactccgtacgccgctccgcctccgtccacaccgaggcgaccggccagatc
tccctgacctactacgaggcgggggagcccaccgacgtgggcgccgggctgccgctggtg
atgctgcacggcggtgggcccggcgcctcgtcgtggtcgaacttcggcccggcgctgccc
ggcttcgccgagtccttccggaccctgctggtcgaccagcccggcttcgggggctccgac
aagccgccggtggtgggcaactactaccgcttcgccgccgacgcggtcgtcgcgctgctc
gacgagctcggcatcgagcgggtccacctgctcggcaacagcctgggcggcggcaccgcc
gtacgcctggcgctgtcgcaccccgaccgggtcggtcgactggtcctgatgggtcccggc
ggcctgtcgctcaacctgttccacgccgaccccaccgagggcgtgcagcgcctgatggag
ttcggcggcgacccgacccccgagcggctgcgcgccttcatctccaccatggtcgtcgac
cagtcgctggtcaccgacgagctggtggcggcgcgcttcgccgacgccaccagtcccggt
gcgcaggacgcgatgcggtcgatgggcatgtccttctggaatcctgagaccgcagaggac
gggatgctctggcgtgaggcccaccggttgcgccagcacaccctgttgacctggggccgc
gaggaccgcgtcaaccccctcgacggtgccatggcggcgctgaagctgatcccgcgcgca
cggctgcacgtgttcccgaactgcggccactgggcgcagatcgaggccgccgaggagttc
cgcgaggtggcgaccgccttcctgggccgccacgtcgagcggccccgccgtaccagcgcc
tga

DBGET integrated database retrieval system