KEGG   Nonlabens dokdonensis: DDD_1262Help
Entry
DDD_1262          CDS       T02441                                 

Gene name
murI
Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
ndo  Nonlabens dokdonensis
Pathway
ndo00471  D-Glutamine and D-glutamate metabolism
ndo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ndo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    DDD_1262 (murI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ndo01011]
    DDD_1262 (murI)
Enzymes [BR:ndo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     DDD_1262 (murI)
Peptidoglycan biosynthesis and degradation proteins [BR:ndo01011]
 Precursor biosynthesis
  Racemase
   DDD_1262 (murI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: AGC76389
UniProt: L7W8B5
Position
complement(1367869..1368681)
Genome map
AA seq 270 aa AA seqDB search
MYLVFDTKKMNKNPIGFFDSGVGGTSVWKEVIELLPHENTIYLADSKHAPYGRKSREEII
ALCIKNTEYLLSQNCKIIAVPCNTATTNAISYLRSHYDMPFIGIEPAIKPAALKSDTKKI
GILATKGTLSSELFNKTQKEFAQDVNTIEIVGTGIVELIEAGKKDSEEMYDLLIKITEPF
MISGIDYLVLGCSHYPYIKDRLQELLPNRVRIIDSGAAVARQMLNILKAKNMLNESEKPG
DHVLYSNLQVQTLNSLTSEIANRKVYLLDF
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
ttgtatcttgtatttgatactaagaaaatgaataagaatccgataggcttttttgactct
ggagtaggcggcacaagcgtgtggaaagaagtaatagaattattacctcacgagaatacc
atctacctagccgattcaaaacacgcgccttatggtcgtaagtctcgagaagaaatcatt
gctttatgcattaaaaatacggagtatttattgagccaaaactgtaaaatcattgcagtg
ccatgtaatactgcaactacaaatgcgataagttacttacgatcgcattatgatatgcca
tttatagggatagaaccagctataaagcctgcggcgcttaaaagcgacacaaaaaaaata
ggaattcttgctaccaaaggaacattatctagtgagttatttaataaaacccaaaaagag
tttgctcaagacgttaacaccattgaaatagtaggtacaggcatcgttgaactcattgaa
gctggtaaaaaagattctgaagagatgtatgacctgcttattaaaatcacagaaccgttc
atgatttctggaatagattatttggttttgggatgcagtcattatccctacattaaagat
cgattacaagaattgttacccaacagagtgcgaattatagactctggagcagcggtagca
agacaaatgctcaacattttaaaagcaaaaaacatgctgaatgaaagtgaaaaacctggc
gatcatgtgctttattctaacttacaagtacaaacactaaactctttaactagtgagatt
gctaatagaaaagtgtatttgctggatttttag

DBGET integrated database retrieval system