KEGG   Nonlabens dokdonensis: DDD_1656Help
Entry
DDD_1656          CDS       T02441                                 

Definition
(GenBank) putative uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ndo  Nonlabens dokdonensis
Pathway
ndo00860  Porphyrin and chlorophyll metabolism
ndo01100  Metabolic pathways
ndo01110  Biosynthesis of secondary metabolites
ndo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ndo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DDD_1656
Enzymes [BR:ndo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     DDD_1656
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: AGC76783
UniProt: L7WD05
Position
complement(1774690..1775352)
Genome map
AA seq 220 aa AA seqDB search
MINSILSTKLLTDSQTELILNSGLSITHFDILKIEPVSFEAHDDFTHVIITSKNAIPALL
KYKIMQEHISCVGEKTAQLLNQHHIEPVAVADNASDLAKILINKYPQEKFLYLCGKQRRH
QLPALFQAEKIAFKEHFVYRSIAIMKSFDRIFACVCFYSPRGVIAFAKANPKNKPLIAVC
IGNTTADEARNYYDTIVIANKQTVENTLITAIKSVRNVEK
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgataaacagtattttatctaccaaactactgaccgattctcaaacagaattgatttta
aattcgggactgagcattactcattttgatatccttaaaattgaaccggttagttttgaa
gcgcacgatgatttcactcacgttattattacgagtaaaaatgccattcctgcactttta
aagtataaaataatgcaggagcatatttcctgtgtaggtgagaaaaccgctcagctttta
aatcaacaccacattgaacctgtagctgtagccgataatgccagcgacctcgctaaaata
ttgatcaacaagtatccacaagaaaagtttttatatctatgtggcaagcagcgtagacat
caacttccagcgttatttcaagccgaaaaaatagccttcaaagaacattttgtttatcgt
tctattgccattatgaaaagctttgatcgtatttttgcatgtgtatgtttctatagtcct
cgtggtgttatcgctttcgcgaaagcgaatcctaaaaacaaacctttaattgcagtatgc
ataggaaacacaacagcagatgaagcacgcaactactacgacacaatagtgattgcaaat
aaacaaacagtagaaaacactttaataacagccataaaatcagtacgcaatgttgaaaaa
tga

DBGET integrated database retrieval system