KEGG   Candidatus Nitrosotalea devanaterra: NDEV_0180Help
Entry
NDEV_0180         CDS       T04889                                 

Gene name
hbcS
Definition
(GenBank) 4-hydroxybyturyl-CoA synthetase
  KO
K18593  4-hydroxybutyrate---CoA ligase (ADP-forming) [EC:6.2.1.56]
Organism
ndv  Candidatus Nitrosotalea devanaterra
Pathway
ndv00720  Carbon fixation pathways in prokaryotes
ndv01100  Metabolic pathways
ndv01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ndv00001]
 09100 Metabolism
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    NDEV_0180 (hbcS)
Enzymes [BR:ndv01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.56  4-hydroxybutyrate---CoA ligase (ADP-forming)
     NDEV_0180 (hbcS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_5 Succ_CoA_lig CoA_binding_2 CoA_binding ATP-grasp_2 CPSase_L_D2 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: CUR50945
UniProt: A0A128A0R9
Position
1:171635..173740
Genome map
AA seq 701 aa AA seqDB search
MSESIFLSPKSIAIIGASDKEGSVGRAITSNILKGYTGKILPISPTRETVFDKKAYKSVL
DVPEEIDLAVIITKNDVVPAVLEECGKKKIKGAIVITAGFKEVNEEGAKLERKLAEIAKQ
YNIKIIGPNCLGVMNLAPQTMMNSTFLKVTPKSGGIALVSQSGAICAALVEDASAQGIGF
SSVISMGNKVDLNEVDILKMLAEHEQTKVIVMYLEDMTNGREFLKICKQITRLNKLKKPV
LVLKSGRSPEGAKAAMSHTGALMGSDEIYDALLTQSGAIRVDTMEELFDYAVAFSKQPLP
LKGDLVIVSNAGGPAIISTDACSRIGIKMASIENIRPQINAVIPPWGTSRNPVDIVGDAD
FNRFDHVLNLVLAHPNVGSVITMCTPSATLDYNKLAEVIVTASKKYNKTMLASLMGLDEG
IKNREILAEGGVPYYTYAEKAIRALKAMLRFSQWSQTSEGKIQQFKVNKKKVEQIFAKVK
SEGRKNLLEEEGQEVLKAYGFPVPKSILATKEKEATVAAKKIGYPVVMKISSPQIIHKSD
AGGVKVGLKTPQEVKKTFKEIIKNAKKYDKKAIIKGVLVQEMVKGGKETIVGSKQELGFG
PVVMFGMGGIYVEVLKDVTFRVAPVTDSEADEMISSIKTNKLLQGVRGEKPSDVTKLSDC
IQRISQLVTDFQEIKELDMNPVLVFEKGKGCKVVDVRIGLA
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaatcaatttttctatctccaaaatccattgccataataggagcttctgataag
gagggaagtgtaggacgcgctattacatctaacatactaaaaggatacactggaaaaatt
cttccaatcagtccaacaagagaaacagtatttgataaaaaagcatacaaaagtgttcta
gatgttccagaagaaatagatcttgcagttatcatcacaaaaaatgatgttgttcctgca
gtgcttgaagaatgtggcaaaaagaagatcaagggagcaattgtcatcactgctggattc
aaagaggtcaacgaagagggagcaaaacttgaacgaaaacttgcagaaattgcaaagcaa
tacaatatcaaaattatcggaccaaactgtcttggtgtcatgaacttggcaccacaaacg
atgatgaattctaccttcctcaaggtgaccccaaaatctggaggaattgctcttgtatct
caaagtggtgctatctgtgccgcactagttgaagacgcaagtgctcaaggaataggattt
tcttctgtaattagcatgggcaacaaagtagatctcaacgaagtagatattttaaaaatg
ctcgcagagcatgagcagaccaaagtcattgtaatgtatcttgaagacatgacaaatggt
cgagaatttttgaaaatttgtaaacaaattactagattaaacaaactaaagaaacccgtt
ttggtcctaaaatctggtagaagtccagagggcgcaaaagcagccatgtctcatactggt
gcactcatgggctctgatgaaatctatgatgcattgttaacacaatctggtgcaatcagg
gttgatactatggaagaattatttgattatgcagtagctttctcaaaacaaccattaccg
ctaaagggagatctggttatagtatcaaatgcaggagggcctgcaataatttctacagat
gcttgttcaagaataggaatcaagatggcaagcatagaaaatatacgaccacagataaat
gcagtaattcctccatggggaacttctagaaatccagtagatattgtgggagatgctgat
tttaacagatttgatcatgtgttaaatcttgtacttgctcacccaaatgttggttcagtc
ataacaatgtgtacaccttctgcaacacttgattacaacaagcttgctgaagtaattgtt
actgcttcaaaaaaatacaacaagacaatgcttgcaagtctaatgggtcttgatgaagga
ataaagaatcgagaaattcttgcagaaggtggtgttccgtattacacctatgcagaaaaa
gcaattcgtgcactcaaggcgatgttaagattttcacaatggtctcaaacatctgaagga
aagatacaacagttcaaagtaaacaagaaaaaggtagaacaaatttttgccaaggtaaaa
tctgagggaagaaagaatttgttagaagaggagggacaagaagttttgaaagcatatggt
tttcctgtacctaaaagcattcttgctacaaaggaaaaagaagcaacagttgcagcaaaa
aaaattggatatcctgttgtaatgaagatatcttctccacaaataattcacaagtctgat
gcaggtggagtcaaagtgggattaaagactcctcaggaagtcaaaaagacctttaaggaa
ataataaaaaatgcaaaaaaatatgacaaaaaagctatcatcaaaggagtactggttcaa
gagatggtaaaaggcggtaaagagacaattgtaggttcaaaacaagaactgggatttggt
cctgtagttatgtttggaatgggaggaatctatgttgaagtgctcaaagatgtcacattc
cgagttgcacctgtcacagattctgaagcagatgaaatgatatcatctattaaaacaaac
aagttgttacagggcgtaaggggtgagaaaccatctgatgtaacaaaactttcagattgt
atccaaagaatttctcaacttgttactgatttccaagaaataaaagaacttgacatgaac
ccagtacttgtatttgaaaagggtaagggctgtaaagtagtagatgtaagaattggactt
gcttag

DBGET integrated database retrieval system