KEGG   Neokomagataea sp. Ha5: E3E11_00290Help
Entry
E3E11_00290       CDS       T06092                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
neh  Neokomagataea sp. Ha5
Pathway
neh00471  D-Glutamine and D-glutamate metabolism
neh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:neh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    E3E11_00290
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:neh01011]
    E3E11_00290
Enzymes [BR:neh01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     E3E11_00290
Peptidoglycan biosynthesis and degradation proteins [BR:neh01011]
 Precursor biosynthesis
  Racemase
   E3E11_00290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: QDH15884
Position
73075..73869
Genome map
AA seq 264 aa AA seqDB search
MGTVGALRTLAPDLLIDYLADTALFPYGEQPDHVLISRLVMLLTEATRLLGSTLVVIGCN
TASTLALPALRQALDVPVVGQVPPIRWAGRVSRTRTIGLLATSATARRDYVRKLHTDFAA
DCRLIIHGGRALADLAERAFAGEDLPLTSIAHEVAQLFSQPGGENIDTIGLGCTHYTFLM
PFFRQLGLRDVLWLDPAPAVAQQVLRLVNASAAPPATARDSAPQSRRGVFLMTALPEHTA
EFTSHLKAFGFSGCRVFILSGACA
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgggaactgtaggggccttacgcaccctggcgccggacctgctcattgattatctggcc
gatactgccctttttccctatggcgagcaaccggatcatgtgctgatttcacgccttgtc
atgcttctgacagaagcgacccgcctgctcggttccacgctggtggtcatcggttgcaac
acggccagcaccctggccctgcccgcattgcgccaagcgctggatgtgccggtggtcggg
caggtgccgcctatccgctgggcaggacgggtttcgcgcacgcgcacgatcggcctcctc
gctacctccgctaccgcgcgacgcgattacgtgcgcaagcttcacacggattttgcggca
gattgccgcctcatcattcatggagggcgggcgctggccgacctggctgagcgagccttt
gcaggcgaagatctgcccctaacttccattgctcatgaagtcgcccagcttttcagccag
cctggtggtgagaacatcgacactatcgggctcggatgcacgcattacacatttctgatg
ccctttttccgccagctcggcctcagggacgttctctggcttgatcccgcacctgctgtc
gcccagcaggttctgaggctcgtcaatgcctcagctgcccctcccgcaacagccagggac
tctgcccctcaatcgcgccggggcgttttcctcatgacggccctgcccgagcacacagct
gaattcaccagccatctcaaggcctttggcttcagcggctgccgtgtcttcatactctca
ggtgcctgcgcctga

DBGET integrated database retrieval system